UniProt UniProt http://www.uniprot.org molejon-2012-6 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Cells have been treated with rapamycin Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation molejon-2012-7 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation molejon-2012-1 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation molejon-2012-3 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down western blot western blot Immuno blot Immuno blot Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation molejon-2012-4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down anti tag western anti tag western blot anti tag western Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation molejon-2012-5 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation molejon-2012-8 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation molejon-2012-9 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK vmp1_human Vacuole membrane protein 1 TDC1 VMP1 TMEM49 HSPC292 Transmembrane protein 49 protein protein human Homo sapiens Human MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK vmp1_rat Vacuole membrane protein 1 Vmp1 protein protein rat Rattus norvegicus (Rat) Rat MAENGTNCDQRRGAMSKEQHNGSFTDPSSVNEKKRRDREERQNIVLWRQPLITLQYFSLETLVVLKEWTSKLWHRQSMVVSFFLLLAALVATYYVEGAHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGAISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAETAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIVTFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHRSEAGTAQGENWLSWTFEKLVVAMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK pk3c3_human Phosphatidylinositol 3-kinase catalytic subunit type 3 PIK3C3 Phosphoinositide-3-kinase class 3 Phosphatidylinositol 3-kinase p100 subunit VPS34 hVps34 protein protein human Homo sapiens Human MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK a16l1_human Autophagy-related protein 16-1 APG16-like 1 UNQ9393/PRO34307 ATG16L1 APG16L protein protein human Homo sapiens Human MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY becn1-vmp1-5 1858527 N/A 1858535 unspecified role unspecified role bait bait cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bh3_dom required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 1858536 unspecified role unspecified role prey prey physical association physical association false false false 2e becn1-vmp1-6 1858527 N/A 1858537 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 1858535 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1858538 unspecified role unspecified role prey prey cell lysate cell lysate association association false false false 5a becn1-pik3c3-5 1858528 N/A 1858536 unspecified role unspecified role prey prey N/A 1858535 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1858538 unspecified role unspecified role prey prey cell lysate cell lysate association association false false false 5c Detected after rapamycin treatment becn1-pik3c3-6 1858528 N/A 1858536 unspecified role unspecified role bait bait N/A 1858535 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection N/A 1858538 unspecified role unspecified role prey prey cell lysate cell lysate association association false false false 5d Detected after rapamycin treatment becn1-vmp1-1 1858529 N/A 1858535 unspecified role unspecified role bait bait c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1858537 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 1c becn1-vmp1-3 1858530 N/A 1858535 unspecified role unspecified role prey prey N/A 1858537 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1e vmp1-becn1-1 1858531 N/A 1858535 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q14457:p.Phe123Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 1858537 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1f becn1-vmp1-4 1858532 N/A 1858535 unspecified role unspecified role fluorescence donor fluorescence donor nucl transfection nucleic acid transfection nucl transfection n-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false bh3_dom required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 1858537 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false 2B and C atg16l1-vmp1-1 1858533 N/A 1858537 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1858539 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 7a atg16l1-vmp1-2 1858534 N/A 1858537 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1858535 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component n-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false 7d Detected in ATG5-depleted cells