HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html larock-2012-4 in vitro In vitro lipase assay lipase assay predetermined predetermined participant predetermined LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. millersi@u.washington.edu The Journal of biological chemistry 2012 imex curation LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI., LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. Only protein-protein interactions imex curation larock-2012-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. millersi@u.washington.edu The Journal of biological chemistry 2012 imex curation LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI., LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. Only protein-protein interactions imex curation larock-2012-2 in vitro In vitro pull down pull down tag visualisation tag visualisation LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. millersi@u.washington.edu The Journal of biological chemistry 2012 imex curation LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI., LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. Only protein-protein interactions imex curation larock-2012-3 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. millersi@u.washington.edu The Journal of biological chemistry 2012 imex curation LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI., LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. Only protein-protein interactions imex curation p-nitrophenyl palmitate p-nitrophenyl palmitate (4-nitrophenyl) hexadecanoate 4-Nitrophenyl palmitate Hexadecanoic acid 4-nitrophenyl ester p-nitrophenyl hexadecanoate para-nitrophenyl palmitate paranitrophenyl palmitate 4-nitrophenyl hexadecanoate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rhoa_human Transforming protein RhoA Rho cDNA clone 12 ARHA RHO12 RHOA ARH12 protein protein human Homo sapiens Human MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL a0a0f6b1q8_salt1 STM14_1974 sseJ protein protein salt1 Salmonella typhimurium (strain 14028s / SGSC 2262) MPLSVGQGYFTSSISSEKFNAIKESARLPELSLWEKIKAYFFTTHHAEALECIFNLYHHQELNLTPVQVRGAYIKLRALASQGCKEQFIIESQEHADKLIIKDDNGENILSIEVECHPEAFGLAKEINKSHPKPKNISLGDITRLVFFGDSLSDSLGRMFEKTHHILPSYGQYFGGRFTNGFTWTEFLSSPHFLGKEMLNFAEGGSTSASYSCFNCIGDFVSNTDRQVASYTPSHQDLAIFLLGANDYMTLHKDNVIMVVEQQIDDIEKIISGGVNNVLVMGIPDLSLTPYGKHSDEKRKLKDESIAHNALLKTNVEELKEKYPQHKICYYETADAFKVIMEAASNIGYDTENPYTHHGYVHVPGAKDPQLDICPQYVFNDLVHPTQEVHHCFAIMLESFIAHHYSTE guanosine 5'-[gamma-thio]triphosphate GTP-gamma-S small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rtkn_human Rhotekin RTKN1 RTKN protein protein human Homo sapiens Human MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDLPEDTELQRKLDHEIRMREGACKLLAACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLGKTSRRPSDSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGEHIQDTEMILVDRTLTDISFQSNVLFAEAGPDFELRLELYGACVEEEGALTGGPKRLATKLSSSLGRSSGRRVRASLDSAGGSGSSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLASHEENPAWLPLYGSVCCRLAAQPLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAVNKETRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQWKQCCDEIMKIETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPPPWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQSPV gdp guanosine 5-diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rhoa-ssej-pnpp-1 1790357 N/A 1790361 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A 1790362 unspecified role unspecified role ancillary ancillary ecoli Escherichia coli (strain K12) N/A 1790363 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 1790364 cofactor cofactor coenzyme unspecified role unspecified role lipid cleavage lipid cleavage false false false 1 and S1 ssej-rhoa-pnpp-1 1790357 N/A 1790361 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A 1790362 unspecified role unspecified role ancillary ancillary his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P61586:p.Gly14Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false P61586:p.Phe39Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P61586:p.Arg68Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P61586:p.Leu69Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P61586:p.Leu72Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P61586:p.Phe106Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P61586:p.[Phe39Ala;Leu72Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1790363 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) lipid cleavage lipid cleavage false false false 3A and suppl table 3 guanosine 5'_[gamma_thio]triphosphate-pnpp-1 1790357 N/A 1790365 competitor competitor competitor unspecified role unspecified role N/A gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1790361 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A 1790362 unspecified role unspecified role ancillary ancillary ecoli Escherichia coli (strain K12) N/A 1790363 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 1790364 cofactor cofactor coenzyme unspecified role unspecified role lipid cleavage lipid cleavage false false false 1 and S1 SseJ also competes with the Rho effector binding domains, PKN1 and ROCK, for binding Rho. ssej-rhoa-1 1790358 N/A 1790363 unspecified role unspecified role neutral component neutral component N/A 1790362 unspecified role unspecified role neutral component neutral component N/A 1790364 cofactor cofactor coenzyme unspecified role unspecified role direct interaction direct interaction false false false 2A ssej-rhoa-4 1790358 N/A 1790363 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 1790362 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 1790366 cofactor cofactor coenzyme unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 2B rhoa-ssej-1 1790359 N/A 1790362 unspecified role unspecified role prey prey his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P61586:p.Phe39Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P61586:p.Arg68Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P61586:p.Leu69Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P61586:p.Leu72Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P61586:p.Phe106Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P61586:p.Gly14Val mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1790363 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3B ssej-rhoa-2 1790360 N/A 1790363 unspecified role unspecified role neutral component neutral component myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false A0A0F6B1Q8:p.Phe121Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1790362 unspecified role unspecified role neutral component neutral component ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P61586:p.Gly14Val mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) colocalization colocalization false false false 4A and S2A