UniProt UniProt http://www.uniprot.org ma-2012-9 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu The Journal of biological chemistry 2012 imex curation Only protein-protein interactions ma-2012-10 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu The Journal of biological chemistry 2012 imex curation Only protein-protein interactions ma-2012-8 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Cells have been cultured under normal or starvation conditions Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu The Journal of biological chemistry 2012 imex curation Only protein-protein interactions ma-2012-5 mouse-macrophage Mus musculus macrophage macrophage Macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Wildtype, EAT2a/b-deficient peritoneal macrophages or beclin-1-GFP X beclin-1+/- macrophages have been used. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu The Journal of biological chemistry 2012 imex curation Only protein-protein interactions ma-2012-6 mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Phagosomes - obtained by use of a magnet with cells incubated with E. coli-containing magnetic particles. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu The Journal of biological chemistry 2012 imex curation Only protein-protein interactions ma-2012-7 human-cll_mec1 human chronic lymphocytic leukemia (CLL) MEC-1 cells Human cll_mec1 chronic lymphocytic leukemia (CLL) MEC-1 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Cells have been stimulated with or without LPS Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu The Journal of biological chemistry 2012 imex curation Only protein-protein interactions slaf1_mouse Signaling lymphocytic activation molecule SLAM family member 1 Slam Slamf1 protein protein mouse Mus musculus Mouse MDPKGSLSWRILLFLSLAFELSYGTGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSPWMQYTLVPLGVVIIFILVFTAIIMMKRQGKSNHCQPPVEEKSLTIYAQVQKSGPQEKKLHDALTDQDPCTTIYVAATEPAPESVQEPNPTTVYASVTLPES High-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates mint pi3r4_human Phosphoinositide 3-kinase regulatory subunit 4 PI3-kinase p150 subunit Phosphoinositide 3-kinase adaptor protein PIK3R4 VPS15 protein protein human Homo sapiens Human MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDPTLPLTSYKQELEELKIRLNSAQNCLPFQKASEKASEKAAMLFRQYVRDNLYDRISTRPFLNNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNPADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRTRGELKRAMDIFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDHSIRELVTQMIHREPDKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGHDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITPYLLHFSNDSVPRVRAEALRTLTKVLALVKEVPRNDINIYPEYILPGIAHLAQDDATIVRLAYAENIALLAETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGNYDTELQALHEMVQQKVVTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDSIVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALYALTCMCQLGLLQKPHVYEFASDIAPFLCHPNLWIRYGAVGFITVVARQISTADVYCKLMPYLDPYITQPIIQIERKLVLLSVLKEPVSRSIFDYALRSKDITSLFRHLHMRQKKRNGSLPDCPPPEDPAIAQLLKKLLSQGMTEEEEDKLLALKDFMMKSNKAKANIVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEPDDKRARKHVKQDSNVNEEWKSMFGSLDPPNMPQALPKGSDQEVIQTGKPPRSESSAGICVPLSTSSQVPEVTTVQNKKPVIPVLSSTILPSTYQIRITTCKTELQQLIQQKREQCNAERIAKQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHSLFATCSNDGTVKIWNSQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLKSGLITSFAVDIHQCWLCIGTSSGTMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWVIAAVQGNNEVSMWDMETGDRRFTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK pk3c3_human Phosphatidylinositol 3-kinase catalytic subunit type 3 PIK3C3 Phosphoinositide-3-kinase class 3 Phosphatidylinositol 3-kinase p100 subunit VPS34 hVps34 protein protein human Homo sapiens Human MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK uvrag_human UV radiation resistance-associated gene protein UVRAG p63 protein protein human Homo sapiens Human MSASASVGGPVPQPPPGPAAALPPGSAARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHLCSTEKIYKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKENIYQLLIEWKVCLDGLKYLGQQIHARNQNEIIFGLNDGYYGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNELERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFVCGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK bakor_human Beclin 1-associated autophagy-related key regulator KIAA0831 Autophagy-related protein 14-like protein ATG14 ATG14L protein protein human Homo sapiens Human MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGRDRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMRIEQLKQTICKGNEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHILELTSVIFPIEEVKTGVRDPADVSSESDSAMTSSTVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYSWVEEKKTTQGPDMEQSNPAYTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKKLNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESGDERVSDEETDLGTDWENLPSPRFCDIPSQSVEVSQSQSTQASPPIASSSAGGMISSAAASVTSWFKAYTGHR rubic_human Run domain Beclin-1-interacting and cysteine-rich domain-containing protein RUBCN Beclin-1 associated RUN domain containing protein KIAA0226 protein protein human Homo sapiens Human MRPEGAGMELGGGEERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRDMQSILYHGLIRDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLLVTKSQSLTALPSSTYTPPNSYAQHSYFGSFSSLHQSVPNNGSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSVSALARDSPLTPNEMSSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSSSNLFSSSSSQKPDSAASSLGDQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAPESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFSISESLIAAIELMKCNMMSQCLEEEEVEEEDSDREIQELKQKIRLRRQQIRTKNLLPMYQEAEHGSFRVTSSSSQFSSRDSAQLSDSGSADEVDEFEIQDADIRRNTASSSKSFVSSQSFSHCFLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDGQHADIYKLRIRVRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMAIPSRVLRKWDFSKYYVSNFSKDLLIKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLCHMKNMFKTCRLAKELLDSFDTVPGHLTEDLHLYSLNDLTATRKGELGPRLAELTRAGATHVERCMLCQAKGFICEFCQNEDDIIFPFELHKCRTCEECKACYHKACFKSGSCPRCERLQARREALARQSLESYLSDYEEEPAEALALEAAVLEAT uvrag_mouse UV radiation resistance-associated protein Uvrag1 Uvrag protein protein mouse Mus musculus Mouse MSSCASLGGPVPLPPPGPSAALTSGAPARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHLCDNEKIFKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKEEAFQLLIEWKVYLDGLKYLGQQIHARNQNEIIFGLNDGYYGAPCEHKGHPNAQKNLLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQRLGKEIEEKLRLTSTSNELKKESECLRLKILVLRNELERQKKALGREVAFLHKQQMALQDKGSAFSTEHGKLQLQKDSLSELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNENKDYFVCGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHISNAIPVPKRQSSTFGGADGGFSAGIPSPDKVHRKRASSENERLQYKTPPPSYNSALTQPGVAMPTSGDSERKVAPLSSSLDTSLDFSKENKKAGVDLGSSVSGDHGNSDSGQEQGEALPGHLAAVNGTALPSEQAGPAGTLLPGSCHPAPSAELCCAVEQAEEIIGLEATGFTSGDQLEALSCIPVDSAVAVECDEQVLGEFEEFSRRIYALSENVSSFRRPRRSSDK becn1_mouse Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Becn1 protein protein mouse Mus musculus Mouse MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEEANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQVRYAQIQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK pk3c3_mouse Phosphatidylinositol 3-kinase catalytic subunit type 3 Vps34 Pik3c3 Phosphoinositide-3-kinase class 3 protein protein mouse Mus musculus Mouse MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGSAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNATTRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQTSASESLSNSGVSSGDIDSSQIITNPLPPVASPPPASKAKEVSDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSETGPYGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK slaf1_human Signaling lymphocytic activation molecule SLAMF1 SLAM family member 1 SLAM CDw150 IPO-3 protein protein human Homo sapiens Human MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES slamf1-becn1-3 1885463 N/A 1885469 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection N/A 1885470 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false a VPS34-VPS15 fusion construct has been transfected N/A 1885471 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false a VPS34-VPS15 fusion construct has been transfected N/A 1885472 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1885473 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association false false false 4A (8) atg14-becn1-18 1885463 N/A 1885474 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1885470 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false a VPS34-VPS15 fusion construct has been transfected N/A 1885471 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false a VPS34-VPS15 fusion construct has been transfected N/A 1885473 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association false false false 4B (8) Transfected Slamf1 not precipitated kiaa0226-becn1-1 1885463 N/A 1885475 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1885472 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1885473 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association false false false 4C (7+8) Transfected Slamf1 was not precipitated In Lane 7 there is a band visible for Beclin;possibly endogenous. atg14-becn1-19 1885463 N/A 1885474 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1885473 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection N/A 1885471 unspecified role unspecified role prey prey association association false false false 4B (6) Transfected Slamf1 not precipitated atg14-pik3c3-3 1885463 N/A 1885474 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1885471 unspecified role unspecified role prey prey physical association physical association false false false 4B (5) Transfected Slamf1 not precipitated atg14-pik3c3-4 1885463 N/A 1885474 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1885470 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false a VPS34-VPS15 fusion construct has been transfected N/A 1885471 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false a VPS34-VPS15 fusion construct has been transfected association association false false false 4B (7) kiaa0226-becn1-2 1885463 N/A 1885475 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1885473 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association false false false 4C (5) Transfected Slamf1 was not precipitated kiaa0226-becn1-3 1885463 N/A 1885475 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1885473 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 4C (6) Transfected Slamf1 was not precipitated becn1-slamf1-1 1885464 N/A 1885469 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1885473 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region_containing_bd_and ccd_domains sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false 6A slamf1-becn1-6 1885464 N/A 1885469 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1885470 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false a VPS34-VPS15 fusion construct has been transfected N/A 1885471 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false a VPS34-VPS15 fusion construct has been transfected N/A 1885473 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association false false false 4A (4) and 4B (4) slamf1-becn1-7 1885464 N/A 1885469 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1885472 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1885473 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association false false false 4A (5) and 4C (4) Presence of EGFP-Rubicon does not change the association slamf1-uvrag-1 1885464 N/A 1885469 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1885472 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4A (3) and 4C (3) slamf1-pik3c3-2 1885464 N/A 1885469 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1885470 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false a VPS34-VPS15 fusion construct has been transfected N/A 1885471 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false a VPS34-VPS15 fusion construct has been transfected association association false false false 4A (1) and 4B (3) ATG14L-GFP slamf1-becn1-10 1885464 N/A 1885469 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1885472 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1885470 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false a VPS34-VPS15 fusion construct has been transfected N/A 1885471 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false a VPS34-VPS15 fusion construct has been transfected N/A 1885473 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association false false false 4A (6) slamf1-becn1-4 1885465 N/A 1885469 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1885472 unspecified role unspecified role prey prey N/A 1885471 unspecified role unspecified role prey prey N/A 1885473 unspecified role unspecified role prey prey association association false false false 3b Observed in LPS-stimulated or not stimulated cells. uvrag-becn1-8 1885465 N/A 1885469 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection N/A 1885472 unspecified role unspecified role bait bait N/A 1885471 unspecified role unspecified role prey prey N/A 1885473 unspecified role unspecified role prey prey association association false false false 3b Observed in LPS-stimulated or not stimulated cells. slamf1-becn1-5 1885465 N/A 1885469 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Slamf1 constructs with single mutations tyr288phe, tyr315phe and tyr335phe interact almost equally as the wildtype. A Slamf1 construct (Y288-myc) containing only ITSM 1 (stated to resemble in such Slamf1 isoform short) interacts. A HA-tagged Slamf1-tailless construct (missing the cytoplasmic domain aa 266-343 according UniProt) does not interact N/A 1885473 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 5 A/B slamf1-becn1-8 1885465 N/A 1885469 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1885473 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 4A, (2) and 4B (2), 4C (2) ATG14L-GFP Presence of EGFP-Rubicon does not change the association slamf1-becn1-11 1885465 N/A 1885469 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection Q9QUM4:p.[Tyr288Phe;Tyr315Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9QUM4:p.[Tyr288Phe;Tyr335Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9QUM4:p.[Tyr315Phe;Tyr335Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Slamf1 constructs with single mutations tyr288phe, tyr315phe and tyr335phe interact almost equally as the wildtype. A Slamf1 construct (Y288-myc) containing only ITSM 1 (stated to resemble in such Slamf1 isoform short) interacts. A HA-tagged Slamf1-tailless construct (missing the cytoplasmic domain aa 266-343 according UniProt) does not interact N/A 1885473 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 5C becn1-pik3c3-7 1885466 N/A 1885469 unspecified role unspecified role bait bait N/A 1885476 unspecified role unspecified role prey prey N/A 1885477 unspecified role unspecified role prey prey N/A 1885478 unspecified role unspecified role prey prey association association false false false 1 A/B Also observed in EAT2a/b deficient macrophages slamf1-becn1-1 1885466 N/A 1885469 unspecified role unspecified role bait bait N/A 1885476 unspecified role unspecified role prey prey N/A 1885478 unspecified role unspecified role prey prey N/A 1885477 unspecified role unspecified role prey prey nucl transformation nucleic acid transformation nucl transformation n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1885477 unspecified role unspecified role prey prey association association false false false 1B Observed in beclin-1-GFP X beclin-1+/- macrophages becn1-pik3c3-8 1885467 N/A 1885469 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false A HA-tagged Slamf1-tailless construct (missing the cytoplasmic domain aa 266-343 according UniProt) does not interact N/A 1885476 unspecified role unspecified role unspecified role unspecified role N/A 1885477 unspecified role unspecified role unspecified role unspecified role N/A 1885478 unspecified role unspecified role unspecified role unspecified role association association false false false 1C Rab5 also detected by use of unspecific antibody; not mapped to UniProt. This interaction did not occur when using an HA tagged "Slamf1 tailless" construct as Bait rather than the full-length molecule;the amino acids in this "cytoplasmic tail" construct are not given, but is in the region of aas 226-242 of Slamf1. slamf1-becn1-2 1885468 N/A 1885472 unspecified role unspecified role prey prey N/A 1885471 unspecified role unspecified role prey prey N/A 1885473 unspecified role unspecified role prey prey N/A 1885479 unspecified role unspecified role bait bait association association false false false 3a Observed in LPS-stimulated or not stimulated cells.