UniProt UniProt http://www.uniprot.org liu-2012-4 rat-brl-3a Rat liver BRL-3A cells Rat brl-3a rat liver BRL-3A cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu M., Liu H., Wang X., Chen P., Chen H. chenping10701@hotmail.com International journal of molecular medicine 2012 imex curation Only protein-protein interactions liu-2012-5 rat-brl-3a Rat liver BRL-3A cells Rat brl-3a rat liver BRL-3A cells confocal microscopy confocal microscopy immunostaining immunostaining Liu M., Liu H., Wang X., Chen P., Chen H. chenping10701@hotmail.com International journal of molecular medicine 2012 imex curation Only protein-protein interactions tmub1_rat Transmembrane and ubiquitin-like domain-containing protein 1 Tmub1 Hops Hepatocyte odd protein shuttling protein protein protein rat Rattus norvegicus (Rat) Rat MALIEGVGDEVTVLFSVLACLLVLALAWVSTHTTESTDPLPQSSGTTTPAQPSEAMTAIDSIREEAPGAESPSLRHRGPSAQPEPEAGVTASTPPDSPQEPLLLRLKFLNDSEQVARAWPQDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPHPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP camlg_rat Guided entry of tail-anchored proteins factor CAMLG Camlg Calcium signal-modulating cyclophilin ligand Caml Get2 protein protein rat Rattus norvegicus (Rat) Rat MEPMPSATDGGDRSATPSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEENQTKSKPLDSDILNPLGVPSVSKRVVLGDSVDGGVTDYQPSGGADIRGAQLGDKLDSFIKAPECSSKDGVELRQRNRGDLTADSAPRGSHHGLEQYLSRFEEAMKLRKQLISEKPSQEDGRTTEEFDSFRIFRLVGCALLALVVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKGEKKVKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHEVLEYWGPEVP camlg-tmub1-1 1886773 N/A 1886775 unspecified role unspecified role prey prey N/A 1886776 unspecified role unspecified role bait bait physical association physical association false false false 7 camlg-tmub1-2 1886774 N/A 1886775 unspecified role unspecified role neutral component neutral component N/A 1886776 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6