IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lee-2012-8 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Lee KM., Yu CW., Chiu TY., Sze KH., Shaw PC., Wong KB. kbwong@cuhk.edu.hk Nucleic acids research 2012 imex curation Only protein-protein interactions lee-2012-6 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Lee KM., Yu CW., Chiu TY., Sze KH., Shaw PC., Wong KB. kbwong@cuhk.edu.hk Nucleic acids research 2012 imex curation Only protein-protein interactions lee-2012-7 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Lee KM., Yu CW., Chiu TY., Sze KH., Shaw PC., Wong KB. kbwong@cuhk.edu.hk Nucleic acids research 2012 imex curation Only protein-protein interactions rla0_human 60S acidic ribosomal protein P0 RPLP0 60S ribosomal protein L10E Large ribosomal subunit protein uL10 protein protein human Homo sapiens Human MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAATTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD rla2_human 60S acidic ribosomal protein P2 RPLP2 RPP2 D11S2243E Renal carcinoma antigen NY-REN-44 Large ribosomal subunit protein P2 protein protein human Homo sapiens Human MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD rla1_human 60S acidic ribosomal protein P1 RPLP1 RRP1 Large ribosomal subunit protein P1 protein protein human Homo sapiens Human MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD rplp0-rplp1-rplp2-3 1801245 N/A 1801248 unspecified role unspecified role neutral component neutral component n terminus rplp0 His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region PO sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1801249 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 1801250 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false Figure 5 rplp0-rplp1-1 1801245 N/A 1801248 unspecified role unspecified role neutral component neutral component n terminus rplp0 His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding PO sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1801249 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1801250 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Figure 5 panel 3 rplp1-rplp2-1 1801246 N/A 1801249 unspecified role unspecified role bait bait region rla2-his his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 1801250 unspecified role unspecified role prey prey region NTDP1 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig 4 A, Fig S2 rplp1-rplp2-2 1801247 N/A 1801249 unspecified role unspecified role neutral component neutral component region NTDP2 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region NTDP2 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region NTDP2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1801250 unspecified role unspecified role neutral component neutral component region NTDP1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region NTDP1 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region NTDP1 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) 1801274 1801272 direct interaction direct interaction false false false Table 1