IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ skasko-2015-5 in vitro In vitro solution nmr solution state nmr solution state nmr solution nmr predetermined predetermined participant predetermined Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu The Journal of biological chemistry 2012 Only protein-protein interactions imex curation skasko-2012-1 in vitro In vitro solution nmr solution state nmr solution state nmr solution nmr predetermined predetermined participant predetermined Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins PRE-Paramagnetic Relaxation Enhancement experiment; MTSL labeled proteins (MTSL is a paramagnetic spin label:- S-(2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-l)methyl methanesulfonothioate) were solubilized in DHPC lipid micelles. The PRE effect can influence nuclei separated by a greater distance as when compared to the Nuclear Overhauser Effect (NOE). The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu The Journal of biological chemistry 2012 Only protein-protein interactions imex curation skasko-2015-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu The Journal of biological chemistry 2012 Only protein-protein interactions imex curation skasko-2015-4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu The Journal of biological chemistry 2012 Only protein-protein interactions imex curation skasko-2012-2 in vitro In vitro solid state nmr solid state nmr ssnmr solid state nmr predetermined predetermined participant predetermined Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins BST-2 and Vpu TMDs were embedded in magnetically aligned phospholipid bicelles containing long chain (DMPC) and short chain (DHPC) phospholipids. The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu The Journal of biological chemistry 2012 Only protein-protein interactions imex curation vpu_hv1b1 Protein Vpu U ORF protein Viral protein U vpu protein protein hv1b1 Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1) HIV-1 MQPIQIAIVALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVEMGHHAPWDVDDL bst2_human Bone marrow stromal antigen 2 BST2 Tetherin HM1.24 antigen protein protein human Homo sapiens Human MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ human_bst2_tm-vpu-1 1791040 N/A 1791045 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1791046 unspecified role unspecified role neutral component neutral component tm_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q10589:p.Cys20Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) 1791052 1791049 direct interaction direct interaction false false false 1D and E human_bst2_tm-vpu-2 1791040 N/A 1791045 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P69699:p.[Ala10Phe;Ala14Phe;Ala18Phe] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1791046 unspecified role unspecified role neutral component neutral component N/A his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false tm_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q10589:p.Cys20Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) 1791061 1791057 direct interaction direct interaction false false false 2A and B, 3 bst2-vpu-4 1791041 N/A 1791045 unspecified role unspecified role neutral component neutral component MTSL spin label spin label certain certain sequence position certain certain certain sequence position certain false P69699:p.Gln5Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1791046 unspecified role unspecified role neutral component neutral component N/A his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false tm_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q10589:p.Cys20Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) 1791071 1791068 direct interaction direct interaction false false false 4A -top Helices are stated to be in an anti-parallel orientation bst2-vpu-5 1791041 N/A 1791045 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1791046 unspecified role unspecified role neutral component neutral component tm_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false MTSL spin label spin label certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) 1791079 1791076 direct interaction direct interaction false false false 4A-bottom helices are stated to be in an anti-parallel orientation bst2-vpu-2 1791042 N/A 1791046 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection Q10589:p.[Leu24_Gly25delinsIleGly;Thr45Ile] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q10589:p.Ile26Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q10589:p.Ile34Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q10589:p.Leu37Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q10589:p.Leu41Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 1791045 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection P69699:p.Ala14Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P69699:p.[Ala10Phe;Ala14Phe;Ala18Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P69699:p.Trp22Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1C, 2F, 5C Co-immunoprecipitation of Vpu with BST-2 was much less efficient when the human BST-2 protein ΔLG,T45I was expressed. bst2-vpu-3 1791043 N/A 1791046 unspecified role unspecified role neutral component neutral component N/A 1791045 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false supplemental S1 bst2-vpu-7 1791044 N/A 1791045 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1791046 unspecified role unspecified role neutral component neutral component tm_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) 1791102 1791099 direct interaction direct interaction false false false 4C -LHS,6B. Figure 4C:- Vpu TMD did not experience major structural or topological changes in the presence of the BST2 TMD, based on the almost perfect overlap of the spectra obtained with and without unlabeled BST-2. Figure 6B:-The Delta-LG 24-25,T45I BST-2 TMD mutant induced chemical shift changes in the spectrum of the Vpu TMD that were similar to those induced by the wild type BST-2 TMD (see Figure 1D-EBI-10690892)