HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html deng-2009-5 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Deng X., Li X., Shen Y., Qiu Y., Shi Z., Shao D., Jin Y., Chen H., Ding C., Li L., Chen P., Ma Z. zhiyongma@shvri.ac.cn Virology journal 2009 imex curation Only protein-protein interactions imex curation deng-2009-6 chick-embryonic_fibroblast Chick embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Deng X., Li X., Shen Y., Qiu Y., Shi Z., Shao D., Jin Y., Chen H., Ding C., Li L., Chen P., Ma Z. zhiyongma@shvri.ac.cn Virology journal 2009 imex curation Only protein-protein interactions imex curation deng-2009-7 chick-embryonic_fibroblast Chick embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy tag visualisation tag visualisation Deng X., Li X., Shen Y., Qiu Y., Shi Z., Shao D., Jin Y., Chen H., Ding C., Li L., Chen P., Ma Z. zhiyongma@shvri.ac.cn Virology journal 2009 imex curation Only protein-protein interactions imex curation p53_chick Cellular tumor antigen p53 Tumor suppressor p53 TP53 protein protein chick Gallus gallus (Chicken) Chicken MAEEMEPLLEPTEVFMDLWSMLPYSMQQLPLPEDHSNWQELSPLEPSDPPPPPPPPPLPLAAAAPPPLNPPTPPRAAPSPVVPSTEDYGGDFDFRVGFVEAGTAKSVTCTYSPVLNKVYCRLAKPCPVQVRVGVAPPPGSSLRAVAVYKKSEHVAEVVRRCPHHERCGGGTDGLAPAQHLIRVEGNPQARYHDDETTKRHSVVVPYEPPEVGSDCTTVLYNFMCNSSCMGGMNRRPILTILTLEGPGGQLLGRRCFEVRVCACPGRDRKIEEENFRKRGGAGGVAKRAMSPPTEAPEPPKKRVLNPDNEIFYLQVRGRRRYEMLKEINEALQLAEGGSAPRPSKGRRVKVEGPQPSCGKKLLQKGSD q77q71_9alph R-LORF7 Meq meq MDV005 MDV076 protein protein Gallid herpesvirus 2 Gallid herpesvirus 2 MSQEPEPGAMPYSPADDPSPLDLSLGSTSRRKKRKSHDIPNSPSKHPFPDGLSEEEKQKLERRRKRNRDAARRRRRKQTDYVDKLHEACEELQRANEHLRKEIRDLRTECTSLRVQLACHEPVCPMAVPLTVTLGLLTTPHDPVPEPPICTPPPPSPDEPNAPHCSGSQPPICTPPPPDTEELCAQLCSTPPPPISTPHIIYAPGPSPLQPPICTPPPPDAEELCAQLCSTPPPPICTPHSLFCPPQPPSPEGIFPALCPVTEPCTPPSPGTVYAQLCPVGQAPLFTPSPPHPAPEPERLYARLTEDPEQDSLYSGQIYIQFPSDTQSTVWWFPGDGRP meq-p53-1 1793362 N/A 1793365 unspecified role unspecified role prey prey N/A 1793366 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1B meq-tp53-1 1793363 N/A 1793365 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1793366 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1C meq-tp53-2 1793364 N/A 1793365 unspecified role unspecified role neutral component neutral component gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1793366 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 1D