HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html choi-2010-1 ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Choi J., Shin D., Yoon H., Kim J., Lee CR., Kim M., Seok YJ., Ryu S. sangryu@snu.ac.kr Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Only protein-protein interactions imex curation choi-2010-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Choi J., Shin D., Yoon H., Kim J., Lee CR., Kim M., Seok YJ., Ryu S. sangryu@snu.ac.kr Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Only protein-protein interactions imex curation a0a0h3ni89_salts ptsN G1W50_22275 G1W53_22530 G1W54_22720 G1W55_03685 G1W56_22880 G1W57_03325 G1W59_04720 G1W62_23870 G1W63_22580 G1W64_22770 G1W66_03690 G1W67_23810 G1W69_03685 G1W71_03685 G1W72_06735 G1W73_04720 G1W74_03330 G1W84_06735 G1W85_06730 G1W86_22075 G1W87_22415 G1W89_21595 G1W92_18420 G1W99_14220 G1X00_05995 G1X03_22670 G1X04_08145 G1X06_00160 G1X09_23300 G1X10_22985 G1X11_04785 G1X12_05995 G1X13_22725 G1X15_03025 G1X17_23520 G1X18_06000 G1X19_20565 G1X23_22965 G1X27_00160 G1X29_22835 G1X31_04780 G1X32_22990 G1X35_00370 G1X38_22980 G1X41_15575 G1X42_18425 G1X44_23620 G1X46_04780 G1X47_22725 G1X49_19985 G1X50_23615 G1X51_22595 G1X52_22725 G1X54_03690 G1X57_23585 G1X61_24440 G1X64_23570 G1X66_22505 G1X67_23550 G1X68_23210 G1X69_23000 G1X71_22735 G1X75_03685 G1X76_22715 G1X77_03690 G1X80_22850 G1X84_22735 G1X85_22790 G1X86_23130 G1X87_24305 G1X94_22540 G1X96_22730 G1X98_06730 G1X99_20010 G1Y02_22730 G1Y04_23545 G1Y11_23090 SL1344_3294 protein protein salts Salmonella typhimurium (strain SL1344) MINNDTTLQLSSVLNQECTRSGVHCQSKKRALEIISELAAKQLSLPPQVVFEAILTREKMGSTGIGNGIAIPHGKLEEDTLRAVGVFVQLETPIAFDAIDNQPVDLLFALLVPADQTKTHLHTLSLVAKRLADKTICRRLRAALNDEELYQIITDTEGEQNEA a0a0h3nkv1_salts ssrB G1W50_16275 G1W53_02290 G1W54_02290 G1W55_00570 G1W56_05645 G1W57_00210 G1W59_13670 G1W62_10485 G1W63_02290 G1W64_08050 G1W66_00570 G1W67_10480 G1W69_00570 G1W71_00570 G1W72_15635 G1W73_11690 G1W74_00210 G1W84_16920 G1W85_15475 G1W86_01970 G1W87_16690 G1W89_05075 G1W92_07510 G1W99_00775 G1X00_16380 G1X03_02290 G1X04_10405 G1X06_11910 G1X09_05385 G1X10_02290 G1X11_15225 G1X12_14900 G1X13_05385 G1X15_02555 G1X17_05385 G1X18_16385 G1X19_09330 G1X23_02275 G1X27_05375 G1X29_05385 G1X31_15210 G1X32_04970 G1X35_13160 G1X38_02290 G1X41_01855 G1X42_07510 G1X44_10230 G1X46_15175 G1X47_04955 G1X49_02290 G1X50_07510 G1X51_05385 G1X52_08055 G1X54_00570 G1X57_15400 G1X61_10490 G1X64_10235 G1X66_02290 G1X67_10235 G1X68_02290 G1X69_05650 G1X71_05390 G1X75_00570 G1X76_02290 G1X77_00570 G1X80_02290 G1X84_04975 G1X85_02290 G1X86_16750 G1X87_07530 G1X94_04955 G1X96_16755 G1X98_15475 G1X99_08065 G1Y02_04975 G1Y04_10225 G1Y11_08395 SL1344_1325 protein protein salts Salmonella typhimurium (strain SL1344) MKEYKILLVDDHEIIINGIMNALLPWPHFKIVEHVKNGLEVYNACCAYEPDILILDLSLPGINGLDIIPQLHQRWPAMNILVYTAYQQEYMTIKTLAAGANGYVLKSSSQQVLLAALQTVAVNKRYIDPTLNREAILAELNADTTNHQLLTLRERQVLKLIDEGYTNHGISEKLHISIKTVETHRMNMMRKLQVHKVTELLNCARRMRLIEY ssrb-ptsn-1 1792159 N/A 1792161 unspecified role unspecified role bait bait A0A0H3NI89:p.His73Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false N/A 1792162 unspecified role unspecified role prey prey physical association physical association false false false 3A, Supp 5B ptsn-ssrb-1 1792160 N/A 1792161 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 1792162 unspecified role unspecified role prey prey thioredoxin tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 3B, Supp 5C. Phosphorylated EIIANtr could also bind to the SsrB protein.