IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gahring-2010-4 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bn-page blue native page bn-page anti tag western anti tag western blot anti tag western Gahring LC., Rogers SW. scott.rogers@hsc.utah.edu The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation gahring-2010-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gahring LC., Rogers SW. scott.rogers@hsc.utah.edu The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation gahring-2010-3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. density sedimentation cosedimentation through density gradient density sedimentation anti tag western anti tag western blot anti tag western Gahring LC., Rogers SW. In Fig. 4d, complexes were first immunodepleted by anti-alpha4 before being separated on a sucrose gradiant, followed by anti-tag Western Blot. scott.rogers@hsc.utah.edu The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation gahring-2010-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Gahring LC., Rogers SW. scott.rogers@hsc.utah.edu The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation acha4_rat Neuronal acetylcholine receptor subunit alpha-4 Chrna4 Acra4 protein protein rat Rattus norvegicus (Rat) Rat MANSGTGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSPTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKRPSVVKDNCRRLIESMHKMANAPRFWPEPVGEPGILSDICNQGLSPAPTFCNPTDTAVETQPTCRSPPLEVPDLKTSEVEKASPCPSPGSCPPPKSSSGAPMLIKARSLSVQHVPSSQEAAEDGIRCRSRSIQYCVSQDGAASLADSKPTSSPTSLKARPSQLPVSDQASPCKCTCKEPSPVSPVTVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAAC mint After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane acha5_rat Neuronal acetylcholine receptor subunit alpha-5 Chrna5 Acra5 protein protein rat Rattus norvegicus (Rat) Rat MVQLLAGRWRPTGARRGTRGGLPELSSAAKHEDSLFRDLFEDYERWVRPVEHLSDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFEGASTKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPYITYSFVIKRLPLFYTLFLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHKLPKLLCMRSHADRYFTQREEAESGAGPKSRNTLEAALDCIRYITRHVVKENDVREVVEDWKFIAQVLDRMFLWTFLLVSIIGTLGLFVPVIYKWANIIVPVHIGNTIK achb4_rat Neuronal acetylcholine receptor subunit beta-4 Chrnb4 Acrb4 Neuronal acetylcholine receptor non-alpha-2 chain protein protein rat Rattus norvegicus (Rat) Rat MRGTPLLLVSLFSLLQDGDCRLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELSLSQLISVNEREQIMTTSIWLKQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNADGTYEVSVYTNVIVRSNGSIQWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKSPTAIMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLFTMVLVTFSIVTTVCVLNVHHRSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSLVRVPHPSQLHLATADTAATSALGPTSPSNLYGSSMYFVNPVPAAPKSAVSSHTAGLPRDARLRSSGRFREDLQEALEGVSFIAQHLESDDRDQSVIEDWKFVAMVVDRLFLWVFVFVCILGTMGLFLPPLFQIHAPSKDS achb2_rat Neuronal acetylcholine receptor subunit beta-2 Chrnb2 Acrb2 Neuronal acetylcholine receptor non-alpha-1 chain protein protein rat Rattus norvegicus (Rat) Rat MAGHSNSMALFSFSLLWLCSGVLGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSDVASLDDFTPSGEWDIIALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRLRLRRRQREREGAGALFFREGPAADPCTCFVNPASVQGLAGAFRAEPTAAGPGRSVGPCSCGLREAVDGVRFIADHMRSEDDDQSVREDWKYVAMVIDRLFLWIFVFVCVFGTVGMFLQPLFQNYTATTFLHPDHSAPSSK chrnb4-chrna4-2 1809966 N/A 1809970 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809971 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809972 unspecified role unspecified role neutral component neutral component ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809973 unspecified role unspecified role neutral component neutral component ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig.s 4c, 5b (top right) chrna4-chrna5-2 1809966 N/A 1809970 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809971 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809973 unspecified role unspecified role neutral component neutral component ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig.s 4c, 5b (top right) chrnb4-1 1809966 N/A 1809972 unspecified role unspecified role unspecified role unspecified role ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 physical association physical association false false false Fig.s 4c, 5b (top right) chrna4-chrna5-4 1809966 N/A 1809970 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809972 unspecified role unspecified role neutral component neutral component ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809973 unspecified role unspecified role neutral component neutral component ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5b (top left) chrnb2-chrna4-2 1809967 N/A 1809970 unspecified role unspecified role prey prey N/A 1809973 unspecified role unspecified role bait bait physical association physical association false false false Fig.s 2a (upper left gel), 5a (left gel) chrna5-chrna4-1 1809967 N/A 1809970 unspecified role unspecified role prey prey N/A 1809971 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2a (lower gels) chrnb4-chrna4-3 1809967 N/A 1809970 unspecified role unspecified role prey prey N/A 1809972 unspecified role unspecified role bait bait physical association physical association false false false Fig.s 2a (upper right gel), 5a (right gel) chrna4-chrna5-1 1809968 N/A 1809970 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809971 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4a chrna4-chrna5-3 1809968 N/A 1809970 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809971 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809973 unspecified role unspecified role neutral component neutral component ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4d chrna4-chrna5-5 1809968 N/A 1809970 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809971 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5b (bottom panels) chrnb2-chrna4-9 1809969 N/A 1809970 unspecified role unspecified role prey prey r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809971 unspecified role unspecified role prey prey r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809973 unspecified role unspecified role bait bait physical association physical association false false false Fig. 3a (left gel) chrnb4-chrna4-1 1809969 N/A 1809970 unspecified role unspecified role prey prey r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809971 unspecified role unspecified role prey prey r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809972 unspecified role unspecified role bait bait N/A 1809973 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3a (right gel)