UniProt UniProt http://www.uniprot.org yurchenko-2010-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yurchenko MY., Kovalevska LM., Shlapatska LM., Berdova GG., Clark EA., Sidorenko SP. Origin of CD150/SLAMF1 according to Pubmed 10229804 (cited in Ref. 54) svetasid@onconet.kiev.ua Immunology and cell biology 2010 imex curation Only protein-protein interactions yurchenko-2010-1 human-mp-1 human B lymphoblastoid cell line MP-1 Human mp-1 B lymphoblastoid cell line MP-1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yurchenko MY., Kovalevska LM., Shlapatska LM., Berdova GG., Clark EA., Sidorenko SP. Origin of CD150/SLAMF1 according to Pubmed 10229804 (cited in Ref. 54) svetasid@onconet.kiev.ua Immunology and cell biology 2010 imex curation Only protein-protein interactions sh21a_human SH2 domain-containing protein 1A SH2D1A DSHP SAP Signaling lymphocytic activation molecule-associated protein T-cell signal transduction molecule SAP Duncan disease SH2-protein protein protein human Homo sapiens Human MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP mint Inhibitor of the SLAM self-association. Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the slam cytoplasmic region Defects in SH2D1A are a cause of lymphoproliferative syndrome X-linked type 1 (XLP1) [MIM:308240]; also known as X-linked lymphoproliferative disease (XLPD) or Duncan disease. XLP is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma slaf1_human Signaling lymphocytic activation molecule SLAMF1 SLAM family member 1 SLAM CDw150 IPO-3 protein protein human Homo sapiens Human MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES m4k1_human Mitogen-activated protein kinase kinase kinase kinase 1 HPK1 MAP4K1 MAPK/ERK kinase kinase kinase 1 Hematopoietic progenitor kinase protein protein human Homo sapiens Human MDVVDPDIFNRDPRDHYDLLQRLGGGTYGEVFKARDKVSGDLVALKMVKMEPDDDVSTLQKEILILKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILINDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVSQPGLNRGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPSDEGPGSMGDDGQLSPGVLVRCASGPPPNSPRPGPPPSTSSPHLTAHSEPSLWNPPSRELDKPPLLPPKKEKMKRKGCALLVKLFNGCPLRIHSTAAWTHPSTKDQHLLLGAEEGIFILNRNDQEATLEMLFPSRTTWVYSINNVLMSLSGKTPHLYSHSILGLLERKETRAGNPIAHISPHRLLARKNMVSTKIQDTKGCRACCVAEGASSGGPFLCGALETSVVLLQWYQPMNKFLLVRQVLFPLPTPLSVFALLTGPGSELPAVCIGVSPGRPGKSVLFHTVRFGALSCWLGEMSTEHRGPVQVTQVEEDMVMVLMDGSVKLVTPEGSPVRGLRTPEIPMTEAVEAVAMVGGQLQAFWKHGVQVWALGSDQLLQELRDPTLTFRLLGSPRLECSGTISPHCNLLLPGSSNSPASASRVAGITGL slamf1-map4k1-2 1882654 N/A 1882656 unspecified role unspecified role prey prey human-mp-1 human B lymphoblastoid cell line MP-1 Human mp-1 B lymphoblastoid cell line MP-1 N/A 1882657 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1882658 unspecified role unspecified role prey prey human-mp-1 human B lymphoblastoid cell line MP-1 Human mp-1 B lymphoblastoid cell line MP-1 association association false false false 5b slamf1-map4k1-3 1882654 N/A 1882657 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1882658 unspecified role unspecified role prey prey human-t5-1 human B lymphoblastoid cell line T5-1 Human t5-1 B lymphoblastoid cell line T5-1 physical association physical association false false false 5b slamf1-map4k1-1 1882655 N/A 1882657 unspecified role unspecified role bait bait N/A 1882658 unspecified role unspecified role prey prey physical association physical association false false false 5a