IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ peterson-2009-6 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Peterson JM., Wei Z., Wong GW. Interactions with FLAG-Adiponectin as bait have not been included as the origin of Adiponectin is unclear. gwwong@jhmi.edu Biochemical and biophysical research communications 2009 IMEx Peterson JM., Wei Z., Wong GW., Peterson JM., Wei Z., Wong GW. Only protein-protein interactions imex curation imex curation peterson-2009-7 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column anti tag western anti tag western blot anti tag western Peterson JM., Wei Z., Wong GW. gwwong@jhmi.edu Biochemical and biophysical research communications 2009 IMEx Peterson JM., Wei Z., Wong GW., Peterson JM., Wei Z., Wong GW. Only protein-protein interactions imex curation imex curation c1qt8_human Complement C1q tumor necrosis factor-related protein 8 C1QTNF8 C1q/TNF-related protein 8 UNQ5829/PRO19648 protein protein human Homo sapiens Human MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDLWRGLPRVRPTIDIEILKGEKGEAGVRGRAGRSGKEGPPGARGLQGRRGQKGQVGPPGAACRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAAVLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSGHLVKPAAEL c1qrf_human C1q-related factor C1QL1 C1QRF CRF CTRP14 C1q and tumor necrosis factor-related protein 14 Complement component 1 Q subcomponent-like 1 protein protein human Homo sapiens Human MLLVLVVLIPVLVSSGGPEGHYEMLGTCRMVCDPYPARGPGAGARTDGGDALSEQSGAPPPSTLVQGPQGKPGRTGKPGPPGPPGDPGPPGPVGPPGEKGEPGKPGPPGLPGAGGSGAISTATYTTVPRVAFYAGLKNPHEGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD c1qt1_mouse Complement C1q tumor necrosis factor-related protein 1 Putative secreted protein ZSIG37 C1qtnf1 Zsig37 protein protein mouse Mus musculus Mouse MGSCAQGFMLGCCLLLAITWGPILSLVPRVQEEQQEWEETEELPSPLDPVTRPEETREKYSPRQGEDLPTSRCYRCCDPSTPVYQTIPPPQINITILKGEKGDRGDRGLQGKYGKIGSTGPRGHVGPKGQKGSIGAPGNHCKSQYAAFSVGRKKALHSNDYFQPVVFDTEFVNLYKHFNMFTGKFYCYVPGIYFFSLNVHTWNQKETYLHIMKNEEEVVILYAQVSDRSIMQSQSLMMELREEDEVWVRLFKGERENAIFSDEFDTYITFSGYLVKPASEP c1ql2_mouse Complement C1q-like protein 2 C1q and tumor necrosis factor-related protein 10 C1ql2 C1qtnf10 Ctrp10 protein protein mouse Mus musculus Mouse MALGLLIAVPLLLQAAPPGAAHYEMLGTCRMICDPYSVAPAGGPAGAKAPPPGPSTAALEVMQDLSANPPPPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQLTTSAAGGVGVVSGGTGGGGDTEGEVTSALSAAFSGPKIAFYVGLKSPHEGYEVLKFDDVVTNLGNHYDPTTGKFSCQVRGIYFFTYHILMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFSGFLLYPD c1t9a_human Complement C1q and tumor necrosis factor-related protein 9A C1QTNF9A Complement C1q and tumor necrosis factor-related protein 9 UNQ6503/PRO21380 C1QTNF9 protein protein human Homo sapiens Human MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP c1t9b_human Complement C1q and tumor necrosis factor-related protein 9B C1QTNF9B C1q/TNF-related protein 9B Complement C1q and tumor necrosis factor-related protein 9-like protein protein human Homo sapiens Human MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGCPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDVPIKFDKILYNEFNHYDTAVGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTRDAYVSSEDQASGSIVLQLKLGDEMWLQVTGGERFNGLFADEDDDTTFTGFLLFSSQ adipo_human Adiponectin ADIPOQ ACDC ACRP30 APM1 GBP28 30 kDa adipocyte complement-related protein Adipocyte complement-related 30 kDa protein Adipocyte, C1q and collagen domain-containing protein Adipose most abundant gene transcript 1 protein Gelatin-binding protein protein protein human Homo sapiens Human MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN c1qt9_mouse Complement C1q and tumor necrosis factor-related protein 9 C1qtnf9 protein protein mouse Mus musculus Mouse MRIWWLLLVMGACTRSVFSQDTCRQGHSGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGHPGGPGKDGIRGEKGEPGADGRVEAKGIKGDPGSRGSPGKHGPKGSIGPTGEQGLPGETGPQGQKGDKGEVGPTGPEGLMGSTGPLGPKGLPGPMGPIGKPGPRGEAGPMGPQGEPGVRGMRGWKGDRGEKGKVGEAPLVPKSAFTVGLTVISKFPPPDAPIKFDKILYNELNHYNVATGKFTCHVAGVYYFTYHITVFSRNVQVSLVKNGVKVLHTKDSYMSSEDQASGGIVQELKLGDEVWMQVTGGERFNGLFADEDDDTTFTGFLLFSSS c1ql1-c1qtnf8-1 1809748 N/A 1809750 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1809751 unspecified role unspecified role prey prey c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2D c1ql1-c1qtnf8-2 1809748 N/A 1809750 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1809751 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2E c1qtnf1-c1ql1-1 1809748 N/A 1809752 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1809751 unspecified role unspecified role prey prey c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2H c1qtnf9-c1ql1-1 1809748 N/A 1809753 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1809751 unspecified role unspecified role prey prey c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2H c1qtnf9-c1qtnf9-1 1809748 N/A 1809754 unspecified role unspecified role prey prey c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1809754 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4C c1qtnf9-c1qtnf9b-1 1809748 N/A 1809755 unspecified role unspecified role prey prey c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1809754 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4C c1qtnf9-adipoq-1 1809748 N/A 1809756 unspecified role unspecified role prey prey c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1809754 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4C c1qtnf9b-adipoq-1 1809748 N/A 1809756 unspecified role unspecified role prey prey c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1809755 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4C c1qtnf9-adipoq-2 1809748 N/A 1809751 unspecified role unspecified role prey prey c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1809757 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2H c1qtnf9-c1qtnf9-2 1809749 N/A 1809754 unspecified role unspecified role neutral component neutral component c-terminak flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1809754 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4C The secreted human CTRP9A protein forms predominantly trimers c1qtnf9-c1qtnf9b-2 1809749 N/A 1809755 unspecified role unspecified role prey prey c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1809754 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4C When co-expressed with CTRP9B, the secreted CTRP9A forms trimers and the presumed hexamers and HWM oligomers