HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html zhao-2009-6 chick-msb-1 chick lymphoblastoid cell line Chicken msb-1 chicken lymphoblastoid cell line MSB-1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao Y., Kurian D., Xu H., Petherbridge L., Smith LP., Hunt L., Nair V. venu.gopal@bbsrc.ac.uk The Journal of general virology 2009 imex curation For the MEQ protein UniProt accession number Q9DGW5 has been used, taken from the reference proteome, as no Meq entry is available for strains used in this publication. Only protein-protein interactions imex curation zhao-2009-4 chick-embryonic_fibroblast Chick embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy immunostaining immunostaining Zhao Y., Kurian D., Xu H., Petherbridge L., Smith LP., Hunt L., Nair V. venu.gopal@bbsrc.ac.uk The Journal of general virology 2009 imex curation For the MEQ protein UniProt accession number Q9DGW5 has been used, taken from the reference proteome, as no Meq entry is available for strains used in this publication. Only protein-protein interactions imex curation zhao-2009-5 chick-msb-1 chick lymphoblastoid cell line Chicken msb-1 chicken lymphoblastoid cell line MSB-1 confocal microscopy confocal microscopy immunostaining immunostaining Zhao Y., Kurian D., Xu H., Petherbridge L., Smith LP., Hunt L., Nair V. venu.gopal@bbsrc.ac.uk The Journal of general virology 2009 imex curation For the MEQ protein UniProt accession number Q9DGW5 has been used, taken from the reference proteome, as no Meq entry is available for strains used in this publication. Only protein-protein interactions imex curation zhao-2009-7 chick-mononuclear-cell chick-mononuclear-cell Chicken mononuclear cells A cell having only one nucleus;this includes lymphocytes, monocytes, dendritic cells and macrophages. tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Zhao Y., Kurian D., Xu H., Petherbridge L., Smith LP., Hunt L., Nair V. cells were derived from virus-induced lymphoma tissue. venu.gopal@bbsrc.ac.uk The Journal of general virology 2009 imex curation For the MEQ protein UniProt accession number Q9DGW5 has been used, taken from the reference proteome, as no Meq entry is available for strains used in this publication. Only protein-protein interactions imex curation hsp70_chick Heat shock 70 kDa protein protein protein chick Gallus gallus (Chicken) Chicken MSGKGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKYDDPTVQSDMKHWPFRVVNEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGKKVETAVITVPAYFNDSQRQATKDAGTITGLNVMRIINEPTAAAIAYGLDKKGTRAGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNRFVEEFKGKHKRDNAGNKRAVRRLRTACERARRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAEDEANRDRVGAKNSLESYTYNMKQTVEDEKLKGKISDQDKQKVLDKCQEVISSLDRNQMAEKEEYEHKQKELEKLCNPIVTKLYQGAGGAGAGGSGGPTIEEVD meq_gahvm Oncoprotein MEQ MDV005 MDV076 protein protein gahvm Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GaHV-2 Marek's disease herpesvirus type 1 MSQEPEPGAMPYSPADDPSPLDLSLGSTSRRKKRKSHDIPNSPSKHPFPDGLSEEEKQKLERRRKRNRDAARRRRRKQTDYVDKLHEACEELQRANEHLRKEIRDLRTECTSLRVQLACHEPVCPMAVPLTVTLGLLTTPHDPVPEPPICTPPPPSPDEPNAPHCSGSQPPICTPPPPDTEELCAQLCSTPPPPISTPHIIYAPGPSPLQPPICTPAPPDAEELCAQLCSTPPPPICTPHSLFCPPQPPSPEGIFPALCPVTEPCTPPSPGTVYAQLCPVGQVPLFTPSPPHPAPEPERLYARLTEDPEQDSLYSGQIYTQFPSDTQSTVWWFPGDGRP hsp70_chick-meq_gahvm-2 1809943 N/A 1809947 unspecified role unspecified role prey prey N/A 1809948 unspecified role unspecified role bait bait physical association physical association false false false 2A hsp70_chick-meq_gahvm-3 1809943 N/A 1809947 unspecified role unspecified role bait bait N/A 1809948 unspecified role unspecified role prey prey physical association physical association false false false 2B meq-hsp70-1 1809944 N/A 1809947 unspecified role unspecified role neutral component neutral component N/A 1809948 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1E hsp70_chick-meq_gahvm-1 1809945 N/A 1809947 unspecified role unspecified role neutral component neutral component N/A 1809948 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1F meq_gahvm-hsp70_chick-1 1809946 N/A 1809947 unspecified role unspecified role prey prey N/A 1809948 unspecified role unspecified role bait bait N/A flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A zz tag zz tag ZZ tag ZZ tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 3