UniProt UniProt http://www.uniprot.org koizumi-2008-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Koizumi M., Fujino A., Fukushima K., Kamimura T., Takimoto-Kamimura M. m.kamimura@teijin.co.jp Journal of synchrotron radiation 2008 Only protein-protein interactions imex curation imex curation mimix curation elne_human Neutrophil elastase Elastase-2 ELANE PMN elastase Bone marrow serine protease Medullasin Human leukocyte elastase ELA2 protein protein human Homo sapiens Human MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH slpi_human Antileukoproteinase SLPI WAP4 WFDC4 Secretory leukocyte protease inhibitor HUSI-1 Seminal proteinase inhibitor BLPI Mucus proteinase inhibitor WAP four-disulfide core domain protein 4 Protease inhibitor WAP4 protein protein human Homo sapiens Human MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA elane-slpi-1 1857328 N/A 1857329 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1857330 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false Fig 1a 1.70 A R-working: 0.203 R-free: 0.231 The sequence numbering for HNE (Leucocyte Elastase) -amino acids 30-247 - was taken from PDBe web site; however this numbering is not given in the publication nor on the Suppliers web site (Elastin Products Company).