IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ni-2007-1 Brahma-related gene 1-dependent STAT3 recruitment at IL-6-inducible genes. human-sw13 human sw13 cells from bone sw13 SW1353 Species: human, Caucasian female 72 years old; Tissue: bone; Tumor: chondrosarcoma ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Ni Z., Bremner R. IBD - Inflammatory bowel disease The adenoviral BRG1 expression construct was confirmed to be of human origin by the corresponding author via e-mail. bremner@lunenfeld.ca J. Immunol. (0022-1767) 2007 Only protein-protein interactions imex curation ni-2007-2 Brahma-related gene 1-dependent STAT3 recruitment at IL-6-inducible genes. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Ni Z., Bremner R. IBD - Inflammatory bowel disease The adenoviral BRG1 expression construct was confirmed to be of human origin by the corresponding author via e-mail. bremner@lunenfeld.ca J. Immunol. (0022-1767) 2007 Only protein-protein interactions imex curation stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D ifm3_human_gene Interferon-induced transmembrane protein 3 (IFITM3) human gene gene gene human Homo sapiens Human if16_human_gene Gamma-interferon-inducible protein 16 (IFI16) human gene gene gene human Homo sapiens Human irf1_human_gene Interferon regulatory factor 1 (IRF1) human gene gene gene human Homo sapiens Human irf9_human_gene Interferon regulatory factor 9 (IRF9) human gene gene gene human Homo sapiens Human h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG smca4_human Transcription activator BRG1 SMARCA4 BRG1 SNF2B SNF2L4 ATP-dependent helicase SMARCA4 SNF2-beta BAF190A Mitotic growth and transcription activator Protein BRG-1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 Protein brahma homolog 1 BRG1-associated factor 190A protein protein human Homo sapiens Human MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED ifit1_human_gene Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1) human gene gene gene human Homo sapiens Human stat3-ifm3-1 1774268 n/a 1774270 unspecified role unspecified role bait bait n/a 1774271 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3a, 3b human interleukin-6 (IL-6) (P05231) human BRG1/SMARCA4 (P51532) IL-6-induced binding of STAT3 to the IFITM3 promoter only occurred in the presence of BRG1, while expression of BRG1 resulted in increased binding of STAT3 to the IFITM3 promoter only when cells were treated with IL-6. P05231 and P51532 increases binding of P40763 to ENSG00000142089 P05231 and P51532 and P40763 increases expression at RNA level of ENSG00000142089 stat3-if16-1 1774268 n/a 1774270 unspecified role unspecified role bait bait n/a 1774272 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3a, 3b human interleukin-6 (IL-6) (P05231) human BRG1/SMARCA4 (P51532) IL-6-induced binding of STAT3 to the IFI16 promoter only occurred in the presence of BRG1, while expression of BRG1 resulted in increased binding of STAT3 to the IFI16 promoter only when cells were treated with IL-6. P05231 and P51532 increases binding of P40763 to ENSG00000163565 P05231 and P51532 and P40763 increases expression at RNA level of ENSG00000163565 stat3-irf1-1 1774268 n/a 1774273 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1774270 unspecified role unspecified role bait bait association association false false false Fig. 3b human interleukin-6 (IL-6) (P05231) human BRG1/SMARCA4 (P51532) IL-6-induced binding of STAT3 to the IRF1 promoter only occurred in the presence of BRG1, while expression of BRG1 resulted in increased binding of STAT3 to the IRF1 promoter only when cells were treated with IL-6. P05231 and P51532 increases binding of P40763 to ENSG00000125347 stat3-irf9-1 1774268 n/a 1774274 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1774270 unspecified role unspecified role bait bait association association false false false Fig. 3b human interleukin-6 (IL-6) (P05231) P05231 increases binding of P40763 to ENSG00000213928 P05231 indirectly increases expression at RNA level of ENSG00000213928 hist1h4a-if16-1 1774268 n/a 1774275 unspecified role unspecified role bait bait possible acetyllys naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1774272 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4 human interleukin-6 (IL-6) (P05231) human BRG1/SMARCA4 (P51532) IL-6-induced binding of H4 to the IFI16 promoter only occurred in the presence of BRG1, while expression of BRG1 resulted in increased binding of H4 to the IFI16 promoter only when cells were treated with IL-6. P05231 and P51532 increases binding of P62805 to ENSG00000163565 hist1h4a-ifm3-1 1774268 n/a 1774271 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1774275 unspecified role unspecified role bait bait possible acetyllys naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4 human interleukin-6 (IL-6) (P05231) human BRG1/SMARCA4 (P51532) IL-6-induced binding of H4 to the IFITM3 promoter only occurred in the presence of BRG1, while expression of BRG1 resulted in increased binding of H4 to the IFITM3 promoter only when cells were treated with IL-6. P05231 and P51532 increases binding of P62805 to ENSG00000142089 hist1h4a-irf9-1 1774268 n/a 1774274 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1774275 unspecified role unspecified role bait bait possible acetyllys naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4 human interleukin-6 (IL-6) (P05231) P05231 increases binding of P62805 to ENSG00000213928 smarca4-irf1-1 1774269 n/a 1774276 unspecified role unspecified role bait bait n/a 1774273 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5 smarca4-ifit1-1 1774269 n/a 1774276 unspecified role unspecified role bait bait n/a 1774277 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5 smarca4-if16-1 1774269 n/a 1774276 unspecified role unspecified role bait bait n/a 1774272 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5