IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhu-2005-4 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. fluorescence fluorescence technology fluorescence antibody detection identification by antibody antibody detection Zhu C., Anderson AC., Schubart A., Xiong H., Imitola J., Khoury SJ., Zheng XX., Strom TB., Kuchroo VK. IBD - Inflammatory bowel disease Galectins were cloned into an IRES2 expression vector that bicistronically expressed EGFP; it has been assumed that GFP fluorescence detection corresponds to presence of galectins. TIM-Ig fusion protein were detected by phycoerythrin conjugated–anti-human IgG. The interactions were detected by Flow Cytometry; only Tim-3–Ig fusion proteins co-stained galectin transfectants. vkuchroo@rics.bwh.harvard.edu Nature immunology 2005 Only protein-protein interactions imex curation imex curation zhu-2005-5 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Zhu C., Anderson AC., Schubart A., Xiong H., Imitola J., Khoury SJ., Zheng XX., Strom TB., Kuchroo VK. IBD - Inflammatory bowel disease vkuchroo@rics.bwh.harvard.edu Nature immunology 2005 Only protein-protein interactions imex curation imex curation zhu-2005-3 in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Zhu C., Anderson AC., Schubart A., Xiong H., Imitola J., Khoury SJ., Zheng XX., Strom TB., Kuchroo VK. IBD - Inflammatory bowel disease vkuchroo@rics.bwh.harvard.edu Nature immunology 2005 Only protein-protein interactions imex curation imex curation leg9_mouse Galectin-9 Lgals9 protein protein mouse Mus musculus Mouse MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQNSAAPVQHVFSTLQFSQPVQFPRTPKGRKQKTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT Binds galactosides. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. Is a ligand for HAVCR2/TIM3. Induces T-helper type 1 lymphocyte (Th1) death mint havr2_mouse Hepatitis A virus cellular receptor 2 homolog Havcr2 Tim3 Timd3 T-cell immunoglobulin and mucin domain-containing protein 3 T-cell membrane protein 3 T-cell immunoglobulin mucin receptor 3 protein protein mouse Mus musculus Mouse MFSGLTLNCVLLLLQLLLARSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIRTAIHIGVGVSAGLTLALIIGVLILKWYSCKKKKLSSLSLITLANLPPGGLANAGAVRIRSEENIYTIEENVYEVENSNEYYCYVNSQQPS leg1_mouse Galectin-1 Lgals1 Gbp Lectin galactoside-binding soluble 1 Beta-galactoside-binding lectin L-14-I S-Lac lectin 1 Galaptin 14 kDa lectin Lactose-binding lectin 1 protein protein mouse Mus musculus Mouse MACGLVASNLNLKPGECLKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNTKEDGTWGTEHREPAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYMAADGDFKIKCVAFE leg3_mouse Galectin-3 Lgals3 35 kDa lectin Carbohydrate-binding protein 35 Galactose-specific lectin 3 IgE-binding protein L-34 galactoside-binding lectin Laminin-binding protein Lectin L-29 Mac-2 antigen protein protein mouse Mus musculus Mouse MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI leg4_mouse Galectin-4 Lgals4 Lactose-binding lectin 4 protein protein mouse Mus musculus Mouse MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI alpha-lactose alpha-lactose 1-beta-D-Galactopyranosyl-4-alpha-D-glucopyranose 4-O-beta-D-galactopyranosyl-alpha-D-glucopyranose alpha-Lactose Anhydrous lactose beta-D-Galp-(1->4)-alpha-D-Glcp Lactose LACTOSE Milk sugar beta-D-galactopyranosyl-(1->4)-alpha-D-glucopyranose beta-D-galactopyranosyl-(1->4)-alpha-D-glucose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) o08573-2 Galectin-9 Lgals9 Short D5 protein protein mouse Mus musculus Mouse MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT q9xbm8_elime png protein protein elime Elizabethkingia meningoseptica APADNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTAVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVVQYNKSSIDGVPYGKAHTLALKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNSNTFQHQLGALGCSANPINNQSPGNWTPDRAGWCPGMAVPTRIDVLNNSLIGSTFSYEYKFQNWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTN havcr2-lgals9-2 1860706 N/A 1860709 unspecified role unspecified role unspecified role unspecified role regions_present_in_isoform2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1860710 unspecified role unspecified role unspecified role unspecified role c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trp217gly variant variant certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 3 havcr2-lgals1-1 1860706 N/A 1860710 unspecified role unspecified role unspecified role unspecified role c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trp217gly variant variant certain certain sequence position certain certain certain sequence position certain false N/A 1860711 unspecified role unspecified role unspecified role unspecified role colocalization colocalization false false false 3C weak interaction havcr2-lgals3-1 1860706 N/A 1860710 unspecified role unspecified role unspecified role unspecified role c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trp217gly variant variant certain certain sequence position certain certain certain sequence position certain false N/A 1860712 unspecified role unspecified role unspecified role unspecified role colocalization colocalization false false false 3Ci weak interaction havcr2-lgals3-2 1860706 N/A 1860710 unspecified role unspecified role unspecified role unspecified role c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trp217gly variant variant certain certain sequence position certain certain certain sequence position certain false N/A 1860713 unspecified role unspecified role unspecified role unspecified role colocalization colocalization false false false 3Cii weak interaction havcr2-lgals9-5 1860706 N/A 1860714 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1860710 unspecified role unspecified role unspecified role unspecified role c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trp217gly variant variant certain certain sequence position certain certain certain sequence position certain false N/A 1860715 unspecified role unspecified role unspecified role unspecified role colocalization colocalization false false false 4B havcr2-lgals9-6 1860706 N/A 1860710 unspecified role unspecified role unspecified role unspecified role signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trp217gly variant variant certain certain sequence position certain certain certain sequence position certain false N/A 1860715 unspecified role unspecified role unspecified role unspecified role O08573-2:p.Arg64Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false O08573-2:p.Arg238Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false O08573-2:p.[Arg64Ala;Arg238Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 4C havcr2-lgals9-3 1860707 N/A 1860715 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 1860710 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trp217gly variant variant certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false 4A havcr2-lgals9-4 1860707 N/A 1860714 inhibitor inhibitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1860715 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 1860710 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trp217gly variant variant certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 4A havcr2-lgals9-7 1860707 N/A 1860716 inhibitor inhibitor prey prey elime Elizabethkingia meningoseptica N/A 1860715 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 1860710 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trp217gly variant variant certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 4D havcr2-lgals9-1 1860708 N/A 1860709 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mouse-tk-1 mouse-TK-1 T lymphocyte/lymphoblast ,T-cell lymphoma cell line Mouse tk-1 TK-1-mouse T lymphocyte/lymphoblast ,T-cell lymphoma cell line http://www.lgcstandards-atcc.org/products/all/CRL-2396 N/A 1860710 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trp217gly variant variant certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 2B