IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bogaerts-2005-2 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F., Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F. F.Vanroy@dmbr.UGent.be Experimental cell research 2005 Only protein-protein interactions imex curation imex curation bogaerts-2005-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F., Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F. F.Vanroy@dmbr.UGent.be human kidney cDNA Experimental cell research 2005 Only protein-protein interactions imex curation imex curation bogaerts-2005-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F., Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F. F.Vanroy@dmbr.UGent.be Experimental cell research 2005 Only protein-protein interactions imex curation imex curation bogaerts-2005-4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F., Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F. F.Vanroy@dmbr.UGent.be human kidney cDNA Experimental cell research 2005 Only protein-protein interactions imex curation imex curation bogaerts-2005-5 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F., Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F. F.Vanroy@dmbr.UGent.be Experimental cell research 2005 Only protein-protein interactions imex curation imex curation bogaerts-2005-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F., Bogaerts S., Vanlandschoot A., van Hengel J., van Roy F. F.Vanroy@dmbr.UGent.be Experimental cell research 2005 Only protein-protein interactions imex curation imex curation ctna2_human Catenin alpha-2 CTNNA2 CAPR Alpha N-catenin Alpha-catenin-related protein protein protein human Homo sapiens Human MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHLPTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF zn639_human Zinc finger protein 639 ZNF639 ZASC1 Zinc finger protein ZASC1 Zinc finger protein ANC_2H01 protein protein human Homo sapiens Human MNEYPKKRKRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDLKYFDNKDDDSDTETSNDLPKFADGIKARNRNQNYLVPSPVLRILDHTAFSTEKSADIVICDEECDSPESVNQQTQEESPIEVHTAEDVPIAVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQHMILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIADTHFSDHLYWCEQCDVQFSSSSELYLHFQEHSCDEQYLCQFCEHETNDPEDLHSHVVNEHACKLIELSDKYNNGEHGQYSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHSADLPHKCSDCLMRFGNERELISHLPVHETT ctnna2-znf639-2 1877138 N/A 1877144 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1877145 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig.2A znf639-ctnna2-1 1877138 N/A 1877144 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1877145 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig.2A ctnna2-znf639-1 1877139 N/A 1877144 unspecified role unspecified role bait bait N/A 1877145 unspecified role unspecified role prey prey physical association physical association false false false znf639-ctnna2-2 1877140 N/A 1877144 unspecified role unspecified role prey prey N/A 1877145 unspecified role unspecified role bait bait n-terminal e-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig.2B ctnna2-znf639-3 1877141 N/A 1877144 unspecified role unspecified role bait bait N/A 1877145 unspecified role unspecified role prey prey n-terminal e-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig.2B ctnna2-znf639-4 1877142 N/A 1877144 unspecified role unspecified role neutral component neutral component N/A 1877145 unspecified role unspecified role neutral component neutral component n-terminal e-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 3F Similar results observed using CTNNAA2 tagged with a mitochondrial location signal but this caused the mitochondria to cluster. ctnna2-znf639-5 1877143 N/A 1877144 unspecified role unspecified role bait bait N/A 1877145 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 5, 6