IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fernandez-2004-1 yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip northern blot northern blot northen Fernandez CF., Pannone BK., Chen X., Fuchs G., Wolin SL. sandra.wolin@yale.edu Molecular biology of the cell 2004 imex curation Only protein-protein interactions imex curation fernandez-2004-3 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Fernandez CF., Pannone BK., Chen X., Fuchs G., Wolin SL. sandra.wolin@yale.edu Molecular biology of the cell 2004 imex curation Only protein-protein interactions imex curation fernandez-2004-2 yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip northern blot northern blot northen Fernandez CF., Pannone BK., Chen X., Fuchs G., Wolin SL. sandra.wolin@yale.edu Molecular biology of the cell 2004 imex curation Only protein-protein interactions imex curation fernandez-2004-4 yeast Saccharomyces cerevisiae Baker's yeast cosedimentation cosedimentation northern blot northern blot northen Fernandez CF., Pannone BK., Chen X., Fuchs G., Wolin SL. sandra.wolin@yale.edu Molecular biology of the cell 2004 imex curation Only protein-protein interactions imex curation snr5 yeast small nucleolar RNA 5 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast AUCAUUCAAUAAACUGAUCUUCCGGAUUACCAUGCUUAAGACAUCACGCCUCCAUAUGUCUAUAUAAAGCGCAAAUGGCUGGAAGUAGACCAAUUUUUUUUGUUCCUAGCUUUUCAUUAUUGAAAUCUAAUCCAGUUUUAAUGGUUUUUCUUAAUUAAGAAAACAAAUUAUCAUUGGUUCGCUCUAGGUGUACAUAUCUUCACU snr7s_u5_yeast small nuclear RNA U5 Yeast snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast AAGCAGCUUUACAGAUCAAUGGCGGAGGGAGGUCAACAUCAAGAACUGUGGGCCUUUUAUUGCCUAUAGAACUUAUAACGAACAUGGUUCUUGCCUUUUACCAGAACCAUCCGGGUGUUGUCUCCAUAGAAACAGGUAAAGCUGUCCGUUACUGUGGGCUUGCCAUAUUUUUUGGAACU snru6_yeast small nuclear RNA U6 Yeast snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast GUUCGCGAAGUAACCCUUCGUGGACAUUUGGUCAAUUUGAAACAAUACAGAGAUGAUCAGCAGUUCCCCUGCAUAAGGAUGAACCGUUUUACAAAGAGAUUUAUUUCGUUUU lsm3_yeast U6 snRNA-associated Sm-like protein LSm3 LSM3 SMX4 USS2 YLR438C-A SmX4 protein protein protein yeast Saccharomyces cerevisiae Baker's yeast METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTPSEDDDGAVEI 787084EF6A5945B7 snr14_u4_yeast SNR14 snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast AUCCUUAUGCACGGGAAAUACGCAUAUCAGUGAGGAUUCGUCCGAGAUUGUGUUUUUGCUGGUUGAAAUUUAAUUAUAAACCAGACCGUCUCCUCAUGGUCAAUUCGGUGUUCGCUUUUGAAUACUUCAAGACUAUGUAGGGAAUUUUUGGAAUACCUUU lsm5_yeast U6 snRNA-associated Sm-like protein LSm5 LSM5 YER146W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLPEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKKTPTEAL 84E8A1E8E2F078FE lsm8_yeast U6 snRNA-associated Sm-like protein LSm8 LSM8 J1464 YJR83.16 YJR022W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIALVGLIDAENDDSLAPIDEKKVPMLKDTKNKIENEHVIWEKVYESKTK B6E37F585B6292EA lsm2_yeast U6 snRNA-associated Sm-like protein LSm2 LSM2 Small nuclear ribonucleoprotein D homolog SNP3 SMX5 SNP3 YBL0425 YBL026W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTERK C23856268CEE92E2 lsm4_yeast U6 snRNA-associated Sm-like protein LSm4 LSM4 SDB23 USS1 YER112W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSKAVKLNEIYIRGTFIKFIKLQDNIIDKVKQQINSNNNSNSNGPGHKRYYNNRDSNNNRGNYNRRNNNNGNSNRRPYSQNRQYNNSNSSNINNSINSINSNNQNMNNGLGGSVQHHFNSSSPQKVEF 69CAC1F01D5BFA98 lsm6_yeast U6 snRNA-associated Sm-like protein LSm6 LSM6 D9481.18 YDR378C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGKASTEGSVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQKI 74FE40A4509CEF33 lsm7_yeast U6 snRNA-associated Sm-like protein LSm7 LSM7 N1202 N1780 YNL147W protein protein yeast Saccharomyces cerevisiae Baker's yeast MHQQHSKSENKPQQQRKKFEGPKREAILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSNPDDENNTELISKNARKLGLTVIRGTILVSLSSAEGSDVLYMQK EA1D019FC5D1B5C5 rsmb_yeast Small nuclear ribonucleoprotein-associated protein B SMB1 Sm protein B YER029C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDGTTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKPNTANAKHTSSNSREIAQPSSSRYNGGNDNIGANRSRFNNEAPPQTRKFQPPPGFKRK 0A1078D5AA241430 snr19_u1_yeast SNR19 snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast AUACUUACCUUAAGAUAUCAGAGGAGAUCAAGAAGUCCUACUGAUCAAACAUGCGCUUCCAAUAGUAGAAGGACGUUAAGCAUUUAUCAUUGAACUAUAAUUGUUCAUUGAAGUCAUUGAUGCAAACUCCUUGGUCACACACACAUACGGCGCGGAAGGCGUGUUUGCUGACGUUUCCAUUCCCUUGUUUCAAUCAUUGGUUAAUCCCUUGAUUCCUUUGGGGAUUUUUGGGUUAAACUGAUUUUUGGGGCCCUUUGUUUCUUCUGCCUGGAGAAGUUUGACACCAAAUUCAAAUUGGUGUUAGGGGAGCUGGGGCCUUUCAAAAGAGAGCUUUGUAGAGGCAUUCUUUUUGACUACUUUUCUCUAGCGUGCCAUUUUAGUUUUUGACGGCAGAUUCGAAUGAACUUAAGUUUAUGAUGAAGGUAUGGCUGUUGAGAUUAUUUGGUCGGGAUUGUAGUUUGAAGAUGUGCUCUUUUGAGCAGUCUCAACUUUGCUCGUUCCCGUUAUGGGAAAAAUUUUGGAAGGUCUUGGUAGGAACGGGUGGAUCUUAUAAUUUUUGAUUUAUUUU smd2_yeast Small nuclear ribonucleoprotein Sm D2 SMD2 YLR275W L9328.5 snRNP core protein D2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSQIIDRPKHELSRAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTPVE 7287070B10E090C0 smd3_yeast Small nuclear ribonucleoprotein Sm D3 SMD3 YLR147C L9634.6 snRNP core protein D3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTMNGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFKKNSSRPMPPIRGPKRR BB02A56C5AD70CF2 ruxe_yeast Small nuclear ribonucleoprotein E SME1 YOR159C Sm protein E protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNKVKTKAMVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKILLKGDNITLITSAD B76D72DA8456F3B5 ruxf_yeast Small nuclear ribonucleoprotein F SMX3 YPR182W P9705.4 Sm protein F protein protein yeast Saccharomyces cerevisiae Baker's yeast MSESSDISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 1640D3237597B2D8 ruxg_yeast Small nuclear ribonucleoprotein G SNP2 YFL017Bw YFL017W-A SMX2 Sm protein G protein protein yeast Saccharomyces cerevisiae Baker's yeast MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIRGNSIISLEALDAI 5C6208B8C5A9AB33 smd1_yeast Small nuclear ribonucleoprotein Sm D1 YGR074W SMD1 snRNP core protein D1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPQPRLNKLNSNGIAMASLYLTGGQQPTASDNIASLQYINIRGNTIRQIILPDSLNLDSLLVDQKQLNSLRRSGQIANDPSKKRRRDFGAPANKRPRRGL 9929F21EB9218447 nhp2_yeast H/ACA ribonucleoprotein complex subunit NHP2 NHP2 YDL208W D1045 H/ACA snoRNP protein NHP2 High mobility group-like nuclear protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKDNKEHKESKESKTVDNYEARMPAVLPFAKPLASKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL 008188132B494E5D snr10_yeast_rna small nucleolar RNA 10 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast AACGCAAAUUUAACAGCCAUUCGUAACACGUACAGUAUCUCGUCGAGGUUGAACCCCUCCGGGGCGUUCUUGACCCAUGAAGAAUGUGGAUUGGUGUUGCAAUAUAUUUAUUAUUGGCUUGGACUGGAGAACAAAUUUAUCGAUCUUGGGUGCAACAGUCUUUCUGUCGUCUGUUUUUUAGCAGAUCUAAGGGUUUACCUUCGUGUGCCCGGAUGAGGACCGUUGCAAGGAUUGAUAAUACAACU snru3a yeast small nuclear RNA U3a Yeast snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast GUCGACGUACUUCAGUAUGUAAUAUACCCCAAACAUUUUACCCACAAAAAACCAGGAUUUGAAAACUAUAGCAUCUAAAAGUCUUAGGUACUAGAGUUUUCAUUUCGGAGCAGGCUUUUUGAAAAAUUUAAUUCAACCAUUGCAGCAGCUUUUGACUAACACAUUCUACAGUAGGAUCAUUUCUAUAGGAAUCGUCACUCUUUGACUCUUCAAAAGAGCCACUGAAUCCAACUUGGUUGAUGAGUCCCAUAACCUUUGUACCCCAGAGUGAGAAACCGAAAUUGAAUCUAAAUUAGCUUGGUCCGCAAUCCUUAGCGGUUCGGCCAUCUAUAAUUUUGAAUAAAAAUUUUGCUUUGCCGUUGCAUUUGUAGUUUUUUCCUUUGGAAGUAAUUACAAUAUUUUAUGGCGCGAUGAUCUUGACCCAUCCUAUGUACUUCUUUUUUGAAGGGAUAGGGCUCUAUGGGUGGGUACAAAUGGCAGUCUGACAAGU gar1_yeast H/ACA ribonucleoprotein complex subunit GAR1 YHR089C GAR1 snoRNP protein GAR1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRGGNRGGRGGFRGGFRGGRTGSARSFQQGPPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLPKPKVVGPPKPKNKKKRSGAPGGRGGASMGRGGSRGGFRGGRGGSSFRGGRGGSSFRGGSRGGSFRGGSRGGSRGGFRGGRR C197FE85644DD0F8 lsm3_rna-1 1859048 N/A 1859052 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false N/A 1859053 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false N/A 1859054 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false N/A 1859055 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859056 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false association association false false false Fig1 lsm5-snru4-1 1859048 N/A 1859057 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859052 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false N/A 1859053 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false N/A 1859054 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false N/A 1859056 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false association association false false false Fig1 lsm8-snru4-1 1859048 N/A 1859058 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859053 unspecified role unspecified role prey prey label 33p radiolabel 33p radiolabel P33 33P certain certain sequence position certain certain certain sequence position certain false N/A 1859054 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false N/A 1859056 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false association association false false false Fig1 lsm2_snr5-1 1859048 N/A 1859054 unspecified role unspecified role prey prey N/A 1859052 unspecified role unspecified role prey prey N/A 1859059 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false Fig2A lsm3_snr5-1 1859048 N/A 1859054 unspecified role unspecified role prey prey N/A 1859052 unspecified role unspecified role prey prey N/A 1859055 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false Fig2A lsm4_snr5-1 1859048 N/A 1859054 unspecified role unspecified role prey prey N/A 1859052 unspecified role unspecified role prey prey N/A 1859060 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false Fig2A lsm5_snr5-1 1859048 N/A 1859054 unspecified role unspecified role prey prey N/A 1859052 unspecified role unspecified role prey prey N/A 1859057 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false Fig2A,B Fig5A lsm6_snr5-1 1859048 N/A 1859054 unspecified role unspecified role prey prey N/A 1859052 unspecified role unspecified role prey prey N/A 1859061 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false Fig2A lsm7_snr5-1 1859048 N/A 1859062 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859052 unspecified role unspecified role prey prey association association false false false Fig2A lsm8_u6-1 1859048 N/A 1859058 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859054 unspecified role unspecified role prey prey association association false false false Fig2A,B smb1-1 1859048 N/A 1859054 unspecified role unspecified role prey prey N/A 1859063 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859064 unspecified role unspecified role prey prey association association false false false Fig2A smd2_u1-1 1859048 N/A 1859054 unspecified role unspecified role prey prey N/A 1859065 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859064 unspecified role unspecified role prey prey association association false false false text smd3_u1-1 1859048 N/A 1859054 unspecified role unspecified role prey prey N/A 1859066 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859064 unspecified role unspecified role prey prey association association false false false sme1-1 1859048 N/A 1859054 unspecified role unspecified role prey prey N/A 1859067 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859064 unspecified role unspecified role prey prey association association false false false smf_u1-1 1859048 N/A 1859054 unspecified role unspecified role prey prey N/A 1859068 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859064 unspecified role unspecified role prey prey association association false false false smg_u1-1 1859048 N/A 1859054 unspecified role unspecified role prey prey N/A 1859069 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859064 unspecified role unspecified role prey prey association association false false false text lms2_srn5-1 1859049 N/A 1859052 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1859054 unspecified role unspecified role prey prey Label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1859059 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false Fig3, Fig4 lsm5-snr5-1 1859049 N/A 1859057 unspecified role unspecified role bait bait Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1859052 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1859054 unspecified role unspecified role prey prey Label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro association association false false false Fig3, Fig4 lsm6-snr5-1 1859049 N/A 1859061 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859052 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1859054 unspecified role unspecified role prey prey Label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro association association false false false Fig3, Fig4 lsm8_snu6-1 1859049 N/A 1859054 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1859058 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig3 smd1_u1-1 1859050 N/A 1859054 unspecified role unspecified role prey prey N/A 1859070 unspecified role unspecified role bait bait N/A 1859064 unspecified role unspecified role prey prey association association false false false Fig2A nhp2-5 1859050 N/A 1859071 unspecified role unspecified role bait bait N/A 1859072 unspecified role unspecified role prey prey N/A 1859052 unspecified role unspecified role prey prey association association false false false Fig5A gar_snr5-1 1859051 N/A 1859073 unspecified role unspecified role neutral component neutral component N/A 1859054 unspecified role unspecified role neutral component neutral component N/A 1859052 unspecified role unspecified role neutral component neutral component N/A 1859074 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1859056 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig5B lsm5_snr5-2 1859051 N/A 1859073 unspecified role unspecified role neutral component neutral component N/A 1859054 unspecified role unspecified role neutral component neutral component N/A 1859052 unspecified role unspecified role neutral component neutral component N/A 1859057 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1859064 unspecified role unspecified role neutral component neutral component N/A 1859056 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig5B