bhf-ucl meyer-2000-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu The EMBO journal 2000 imex curation Only protein-protein interactions meyer-2000-3 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu The EMBO journal 2000 imex curation Only protein-protein interactions meyer-2000-7 in vitro In vitro competition binding competition binding weight by comassie molecular weight estimation by coomasie staining weight by comassie Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu The EMBO journal 2000 imex curation Only protein-protein interactions meyer-2000-6 rat-liver rattus norvegicus liver Rat liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu The EMBO journal 2000 imex curation Only protein-protein interactions meyer-2000-4 rat-liver rattus norvegicus liver Rat liver liver molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu The EMBO journal 2000 imex curation Only protein-protein interactions meyer-2000-5 rat-liver rattus norvegicus liver Rat liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease the complexes in rat liver cytosol were first purified by gel filtration. graham.warren@yale.edu The EMBO journal 2000 imex curation Only protein-protein interactions meyer-2000-1 rat-liver rattus norvegicus liver Rat liver liver pull down pull down ms participant Identification by mass spectrometry ms participant Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease a doublet of 67 and 71 kDa was identified for Npl4. graham.warren@yale.edu The EMBO journal 2000 imex curation Only protein-protein interactions meyer-2000-8 rat-liver rattus norvegicus liver Rat liver liver pull down pull down western blot western blot Immuno blot Immuno blot Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease a doublet of 67 and 71 kDa was identified for Npl4. graham.warren@yale.edu The EMBO journal 2000 imex curation Only protein-protein interactions ufd1_mouse Ubiquitin recognition factor in ER-associated degradation protein 1 Ufd1 Ubiquitin fusion degradation protein 1 homolog Ufd1l protein protein mouse Mus musculus Mouse MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFIAFSGEGQSLRKKGRKP mint homomint Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope (By similarity). It may be involved in the development of some ectoderm-derived structures npl4_rat Nuclear protein localization protein 4 homolog Nploc4 Npl4 protein protein rat Rattus norvegicus (Rat) Rat MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSLHLLKIKHGDLLFLFPSSLAGPSSEMETSTSVGLKAFGAPHVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIASKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNICRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELAQTWKKSEQWATIEQLCSTVGVQLPGLHEFGAVGGSARAATSAMWACQHCTFMNQPGTGHCEMCSLPRT tera_mouse Transitional endoplasmic reticulum ATPase Vcp 15S Mg(2+)-ATPase p97 subunit Valosin-containing protein protein protein mouse Mus musculus Mouse MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG tera_rat Transitional endoplasmic reticulum ATPase Vcp 15S Mg(2+)-ATPase p97 subunit Valosin-containing protein protein protein rat Rattus norvegicus (Rat) Rat MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGNVYTEDNDDDLYG nsf1c_rat NSFL1 cofactor p47 Nsfl1c p97 cofactor p47 XY body-associated protein XY40 protein protein rat Rattus norvegicus (Rat) Rat MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGTAPSDNRVTSFRDLIHDQDEEEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGERRRHSGQDVHVVLKLWKTGFSLDNGDLRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLNTSSPAQQAENEAKASSSILINEAEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEANLLNAVIVQRLT ufd1_rat Ubiquitin recognition factor in ER-associated degradation protein 1 Ufd1 Ubiquitin fusion degradation protein 1 homolog Ufd1l protein protein rat Rattus norvegicus (Rat) Rat MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPMVKKVEEDEAGGRFVAFSGEGQSLRKKGRKP ube4a_rat Ubiquitin conjugation factor E4 A Ube4a RING-type E3 ubiquitin transferase E4 A protein protein rat Rattus norvegicus (Rat) Rat MTDQENNNNISSNPFAALFGSLADAKQFAAIHKEQLKQQSDELPASPDDSDNSVSESLDEFDYSVSEISRSFRTHQEMCEQLNINHMIQRIFLITLDNSDPNLKSGNGIPSRCVYLEEMAVELEDQDWLDMSNVEQAIFARLLLQDPGNHLISMTSSATLNLSADRDAGERHIFCYLYSCFQRAKEEITKVPENLLPFAVQCRNLTVSNTRTVLLTPEIYVDQNIHEQLVDLMLEAIQGAHFEDVTEFLEEVIEALLLDEEVRTFPEVMIPVFDILLGRIKDLELCQILLYAYLDILLYFTRQKDMAKVFLEYIQPKDPSNGQMYQKTLLGVILNISCLLKTPGVVENHGFFLNPSRSSPQEIKVQEANIHQFMAQFHEKIYQMLKNLLQLSPETKHGILFWLGNCLHANAGRTKIWANQMPEIFFQMYASDAFFLNLGAALLKLCQPFCKPRSSRLLTFNPTYCVLKDLNDEERKIKSVHMRGLDKETCLIPAVQEPVFPQSYNLVTENLALTEYTLYLGFHRLHDQMVKINQNLHRLQVAWRDAQQSSSPAADNLREQFERLMTIYLSTKTAMTEPQMLQNCLNLQVSMAVLLVQLAIGNEGSQPIELSFPLPDGYSSLAYVPEFFADNLGDFLIFLRRFAEDILETSADSLEHVLHFITIFTGSIERMKNPHLRAKLAEVLEAVMPHLDQTPSPLVSSVFHRKRVFCNFPYAPQLSEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDSYRESIKDLADYASKNLEAMNPPLFLRFLNLLMNDAIFLLDEAIQYLSKIKIQQIEKDRGEWESLTPEARREKEAGLQMFGQLARFHNIMSNETIGTLSFLTSEIKSLFVHPFLAERIISMLNYFLQHLVGPKMGALKVKDFSEFDFKPQQLVSDICTIYLNLGDEENFCATVPKDGRSYSPTLFAQTVRVLKKINKPGNMIVAFSNLAERIKSLADLQQQEEETYADACDEFLDPIMSTLMSDPVVLPSSRVTVDGSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQKEQLE vcp-nploc4-2 1860135 N/A 1860143 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860144 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860145 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false figure 4a lane 3 in the panel on the right (entitlted 'bound') vcp-nploc4-1 1860135 N/A 1860143 unspecified role unspecified role prey prey purified purified GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860146 unspecified role unspecified role prey prey purified purified naturally occurring naturally occurring endogenous endogenous N/A 1860144 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false figure 4b lane 3 in the panel on the right (entitlted 'bound') nploc4-ufd1l-1 1860135 N/A 1860143 unspecified role unspecified role bait bait purified purified GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860145 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860144 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false figure 4c lane 3 in the panel on the right (entitlted 'bound') vcp-ufd1l-3 1860135 N/A 1860143 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860145 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false figure 4a lane 2 in the panel on the right (entitlted 'bound') nploc4-ufd1l-6 1860135 N/A 1860143 unspecified role unspecified role prey prey purified purified GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860144 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false figure 4b lane 1 in the panel on the right (entitlted 'bound') ufd1l-vcp-1 1860135 N/A 1860143 unspecified role unspecified role bait bait purified purified GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860145 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false figure 4c lane 1 in the panel on the right (entitlted 'bound') ufd1l-nploc4-5 1860135 N/A 1860143 unspecified role unspecified role bait bait purified purified GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860144 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false figure 4c lane 2 in the panel on the right (entitlted 'bound') vcp-nploc4-3 1860136 N/A 1860144 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860145 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false figure 4d lane 3 ufd1l-nploc4-1 1860136 N/A 1860143 unspecified role unspecified role prey prey his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860144 unspecified role unspecified role bait bait biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false figure 4d lane 10 vcp-nploc4-4 1860136 N/A 1860143 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860145 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false figure 4d lane 4 vcp-ufd1l-1 1860136 N/A 1860147 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860145 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false figure 4d lane 5 vcp-nploc4-5 1860136 N/A 1860144 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous rat-liver rattus norvegicus liver Rat liver liver N/A 1860145 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false figure 4d lane 2 nploc4-ufd1l-7 1860136 N/A 1860148 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous rat-liver rattus norvegicus liver Rat liver liver N/A 1860144 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false figure 4d lane 7 nsfl1c-vcp-11 1860137 N/A 1860145 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860147 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false figure 6b left panel lanes 1, 5 and 9. nsfl1c-vcp-10 1860137 N/A 1860143 competitor competitor competitor prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false npl4 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860144 competitor competitor competitor prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ufd1 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860145 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860147 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false figure 6b left panel lanes 2 to 4 nsfl1c-vcp-12 1860137 N/A 1860143 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860145 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false figure 6b right panel lane 13 vcp-ufd1l-2 1860137 N/A 1860143 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860145 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860147 competitor competitor competitor prey prey his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false figure 6b right panel lanes 14 to 16 ufd1l-nploc4-3 1860138 N/A 1860146 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey N/A 1860147 unspecified role unspecified role bait bait physical association physical association false false false figure 6a ufd1l-nploc4-4 1860138 N/A 1860148 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait N/A 1860146 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey N/A 1860144 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey association association false false false figure 6a nploc4-ufd1l-3 1860138 N/A 1860148 unspecified role unspecified role prey prey N/A 1860146 unspecified role unspecified role prey prey N/A 1860144 unspecified role unspecified role bait bait association association false false false figure 6a vcp-nploc4-6 1860139 N/A 1860148 unspecified role unspecified role neutral component neutral component N/A 1860146 unspecified role unspecified role neutral component neutral component N/A 1860144 unspecified role unspecified role neutral component neutral component N/A 1860147 unspecified role unspecified role neutral component neutral component physical association physical association false false false figure 5a nploc4-ufd1l-2 1860139 N/A 1860147 unspecified role unspecified role neutral component neutral component N/A 1860146 unspecified role unspecified role neutral component neutral component physical association physical association false false false figure 5a vcp-nploc4-7 1860140 N/A 1860148 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait cell lysate cell lysate N/A 1860146 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey cell lysate cell lysate N/A 1860144 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey cell lysate cell lysate association association false false false figure 5b ufd1l-nploc4-2 1860140 N/A 1860148 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait cell lysate cell lysate N/A 1860144 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association false false false figure 5b vcp-nploc4-9 1860141 N/A 1860148 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey N/A 1860149 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey N/A 1860145 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role bait bait his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860144 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey N/A 1860147 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey association association false false false figure 1a vcp-nploc4-10 1860142 N/A 1860148 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous N/A 1860145 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860144 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous N/A 1860147 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous association association false false false figure 1b