MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014x-1 Structure and mechanism of the primosome protein DnaT: functional structures for homotrimerization, dissociation of ssDNA from PriB-ssDNA complex and formation of DnaT-ssDNA complex in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined ueda@phar.kyushu-u.ac.jp 2014 imex curation Fujiyama S., Abe Y., Tani J., Urabe M., Sato K., Aramaki T., Katayama T., Ueda T. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014m-2 Structure and mechanism of the primosome protein DnaT: functional structures for homotrimerization, dissociation of ssDNA from PriB-ssDNA complex and formation of DnaT-ssDNA complex in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined ueda@phar.kyushu-u.ac.jp 2014 imex curation Fujiyama S., Abe Y., Tani J., Urabe M., Sato K., Aramaki T., Katayama T., Ueda T. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014t-7 Structure and mechanism of the primosome protein DnaT: functional structures for homotrimerization, dissociation of ssDNA from PriB-ssDNA complex and formation of DnaT-ssDNA complex in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined ueda@phar.kyushu-u.ac.jp 2014 imex curation Fujiyama S., Abe Y., Tani J., Urabe M., Sato K., Aramaki T., Katayama T., Ueda T. FEBS J. (1742-464X) Only protein-protein interactions dnat_ecoli Primosomal protein 1 dnaT b4362 JW4326 Primosomal protein I protein protein ecoli Escherichia coli (strain K12) MSSRVLTPDVVGIDALVHDHQTVLAKAEGGVVAVFANNAPAFYAVTPARLAELLALEEKLARPGSDVALDDQLYQEPQAAPVAVPMGKFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRASNGGLPKRDVNTVSEPDSQIPPGFRG 8DE048A3B2A6235B prib_ecoli Primosomal replication protein N priB b4201 JW4159 protein protein ecoli Escherichia coli (strain K12) MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD dnat-1 1569351 n/a DnaT 1569354 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 3.0 direct interaction direct interaction false false false f4 dnat-1 1569352 n/a DnaT 1569354 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 3.0 direct interaction direct interaction false false false f2 dnat-prib-1 1569353 n/a PriB 1569355 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n/a DnaT 1569354 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P0A8J2:p.Asp70Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1569353 f8e