MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014j-1 Arabidopsis STAYGREEN-LIKE (SGRL) promotes abiotic stress-induced leaf yellowing during vegetative growth in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot sakuraba0425@gmail.com or ncpaek@snu.ac.kr 2014 imex curation Sakuraba Y., Kim D., Kim Y.S., Hörtensteiner S., Paek N.C. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014j-2 Arabidopsis STAYGREEN-LIKE (SGRL) promotes abiotic stress-induced leaf yellowing during vegetative growth yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined sakuraba0425@gmail.com or ncpaek@snu.ac.kr 2014 imex curation Sakuraba Y., Kim D., Kim Y.S., Hörtensteiner S., Paek N.C. FEBS Lett. (0014-5793) Only protein-protein interactions sgrl_arath Magnesium dechelatase SGRL, chloroplastic Protein STAY-GREEN LIKE F9C16.20 At1g44000 SGRL protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MACYIVPYYHHPVLSHPNREIFSHRHHHHHRFCNNLLNRRISVPRSSAISDGGVSYNTLVSEAVRLLVPQANFDSSKLKVEFLGELLENKSNGGIITPRTYILSHCDFTANLTLTISNVINLDQLEGWYKKDDVVAEWKKVNDELRLHIHCCVSGMSLLQDVAAELRYHIFSKELPLVLKAVVHGDSVMFRENPELMDAYVWVYFHSSTPKYNRIECWGPLKDAAKGKQQGNHQGFLSSTTSRKLIRHKSIFHTLFTFLL nol_arath Chlorophyll(ide) b reductase NOL, chloroplastic NOL Protein NON-YELLOW COLORING 1-LIKE Short-chain dehydrogenase/reductase NOL MUG13.25 At5g04900 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATWSGFNVSSSPLLRLRSSSVSNVTKLPFLSPICRRRLLAERFGLATVVVTRQNLTVTPSSAAVEARISGKREPMTPPYNILITGSTKGIGYALAREFLKAGDNVVICSRSAERVETAVQSLKEEFGEHVWGTKCDVTEGKDVRELVAYSQKNLKYIDIWINNAGSNAYSFKPLAEASDEDLIEVVKTNTLGLMLCCREAMNMMLTQSRGGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASGSMKPTYIRFLTGIKAYTKIFSRVALGARKNRYVTEE rccr_arath Red chlorophyll catabolite reductase, chloroplastic RCCR ACD2 Accelerated cell death protein 2 C7A10_360 At4g37000 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMIFCNTLYSSSSPSYLSPLTSKPSRFSKNLRPRAQFQSMEDHDDHLRRKFMEFPYVSPTRKQLMVDLMSTVENRLQSQLLPCNLPPDVRNFNNPNGSAEASLHIRSGDKSSPIDFVIGSWIHCKIPTGVSLNITSISGFLNSSTKAPNFVVELIQSSSKSLVLILDLPHRKDLVLNPDYLKEYYQDTALDSHRQSLLKLPEVNPYVSPSLFVRSAFSPTASMLKIDAEEEDKLEEILRDHVSPAAKEVLEVWLERCVKEEEEKIVVGEEERMELERRDKSFRRKSIEDDLDLQFPRMFGEEVSSRVVHAIKEAFGVL pao_arath Pheophorbide a oxygenase, chloroplastic PAO ACD1 Accelerated cell death 1 Lethal leaf-spot 1 homolog F28D10_70 At3g44880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSVVLLSSTSATITKSQSKKIPFLSPTTKFPLKVSISPSRSKLFHNPLRVAAPPSVPTSDSTEEKRIEEEYGGDKEEEGSEFKWRDHWYPVSLVEDLDPNVPTPFQLLGRDLVLWFDRNDQKWAAFDDLCPHRLAPLSEGRLDENGHLQCSYHGWSFGGCGSCTRIPQAATSGPEARAVKSPRACAIKFPTMVSQGLLFVWPDENGWDRANSIEPPRLPDDFDKPEFSTVTIQRDLFYGYDTLMENVSDPSHIDFAHHKVTGRRDRAKPLPFKVESSGPWGFQGANDDSPRITAKFVAPCYSMNKIELDAKLPIVGNQKWVIWICSFNIPMAPGKTRSIVCSARNFFQFSVPGPAWWQVVPRWYEHWTSNLVYDGDMIVLQGQEKVFLAKSMESPDYDVNKQYTKLTFTPTQADRFVLAFRNWLRRHGKSQPEWFGSTPSNQPLPSTVLTKRQMLDRFDQHTQVCSSCKGAYNSFQILKKFLVGATVFWAATAGVPSDVQIRLVLAGLSLISAASAYALHEQEKNFVFRDYVHSEIE nyc1_arath Probable chlorophyll(ide) b reductase NYC1, chloroplastic NYC1 Protein NON-YELLOW COLORING 1 F17N18.140 At4g13250 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTTLTKIQVYPQVLEHRLFFRDPIRVGSRLTCRERSNRVYVHRCEKKVERKRKVEKFKGNGSWDSLKSGFLGFSKLGFLSKDEYNQKVENLEMVFSSVAVQIARYIVTMTSTGAILLIGFQLSGGDSSMNSLVWYSWLGGIIIGTMTGANMVLEDHYRAGPRNVVITGSTRGLGKALAREFLLSGDRVIVTSRSSESVDMTVKELEQNLKEIMSNASESARKKLSDAKVVGIACDVCKPEDVEKLSNFAVKELGSINIWINNAGTNKGFRPLLEFTEEDITQIVSTNLIGSILCTRGAMDVMSRQHSGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKESQKTNVGLHTASPGMVLTELLLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLAIVTSWLRRGRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIILQSTTPSSFPGT sgr1_arath Magnesium dechelatase SGR1, chloroplastic Protein NONYELLOWING 1 Protein STAY-GREEN 1 SGR1 NYE1 SGN1 Protein STAYGREEN 1 F7H19.100 At4g22920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MCSLSAIMLLPTKLKPAYSDKRSNSSSSSSLFFNNRRSKKKNQSIVPVARLFGPAIFESSKLKVLFLGVDEKKHPSTLPRTYTLTHSDITAKLTLAISQSINNSQLQGWANRLYRDEVVAEWKKVKGKMSLHVHCHISGGHFLLDLFAKFRYFIFCKELPVVLKAFVHGDGNLLNNYPELQEALVWVYFHSNVNEFNKVECWGPLWEAVSPDGHKTETLPEARCADECSCCFPTVSSIPWSHSLSNEGVNGYSGTQTEGIATPNPEKL sgr2_arath Magnesium dechelatase SGR2, chloroplastic Protein NONYELLOWING 2 Protein STAY-GREEN 2 SGR2 NYE2 SGN2 Protein STAYGREEN 2 T26M18.120 At4g11910 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MCSLATNLLLPSKMKPVFPEKLSTSSLCVTTRRSKMKNRSIVPVARLFGPAIFEASKLKVLFLGVDEKKHPAKLPRTYTLTHSDITAKLTLAISQSINNSQLQGWANKLFRDEVVGEWKKVKGKMSLHVHCHISGGHFFLNLIAKLRYYIFCKELPVVLEAFAHGDEYLLNNHPELQESPVWVYFHSNIPEYNKVECWGPLWEAMSQHQHDGRTHKKSETLPELPCPDECKCCFPTVSTIPWSHRHYQHTAADENVADGLLEIPNPGKSKG hcar_arath 7-hydroxymethyl chlorophyll a reductase, chloroplastic HCAR HMCR T1G11.13 At1g04620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MITVVTSRLSLLPPVFSVVNSSSSRSKDMNLEPKKKVKLREDWREKSRPIPPGGTYPAKDHCSQCGLCDTYYIAHVKEACAFLGDGMSRIESLEPVVHGRGRKADSLQDTYFGVHQEQLYARKLKPVEGAQWTGIVTTIAIEMLKSNMVEAVVCVQSDPEDRLSPRPVLARTPEEVLAARGVKPTLSPNLNTLELIEASGVKRLLFCGVGCQVQALRSVEQHLNLEKLYVLGTNCVDNGTRDGLDKFLKAASKEPETVLHYEFMQDYKVQLKHLDGHIEEVPYFSLPANDLVDVIAPSCYSCFDYTNALADLVIGYMGVPKYSGLNMTDHPQYITVRNERGKEMLSLVENLLEITPTISSGDRRPFVTETVKADDAAKFGQGPAQPAPLFVGNIIAFILNLVGPKGLEFARYSLDYHTIRNYLYVNRKWGKQRANTHMPSYAKKIVEMYNKNGQIDKMLSKK nol-nyc1 1567009 n/a SGRL 1567011 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NOL 1567012 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a RCCR 1567013 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PAO 1567014 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a NCY1 1567015 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f4e sgrl-nol-1 1567009 n/a NCY1 1567015 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a SGR1 1567016 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NOL 1567012 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PAO 1567014 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a RCCR 1567013 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f4e sgr1-sgrl 1567009 n/a SGRL 1567011 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a SGR1 1567016 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5a sgr1-sgrl-1 1567009 n/a SGRL 1567011 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a SGR2 1567017 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5b sgr2-sgrl 1567009 n/a SGRL 1567011 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a SGRL 1567011 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5c rccr-sgrl 1567010 n/a SGRL 1567011 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a RCCR 1567013 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4d sgrl-rccr 1567010 n/a SGRL 1567011 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NOL 1567012 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4d sgrl-nol 1567010 n/a HCAR 1567018 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a SGRL 1567011 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4d