MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014t-2 Gpn1 and Gpn3 associate tightly and their protein levels are mutually dependent in mammalian cells human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot mcalera@ifisica.uaslp.mx 2014 imex curation Méndez-Hernández L.E., Pérez-Mejía A.E., Lara-Chacón B., Barbosa-Camacho A.A., Peña-Gómez S.G., Martínez-Sánchez M., Robledo-Rivera A.Y., Sánchez-Olea R., Calera M.R. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014h-1 Gpn1 and Gpn3 associate tightly and their protein levels are mutually dependent in mammalian cells human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining mcalera@ifisica.uaslp.mx 2014 imex curation Méndez-Hernández L.E., Pérez-Mejía A.E., Lara-Chacón B., Barbosa-Camacho A.A., Peña-Gómez S.G., Martínez-Sánchez M., Robledo-Rivera A.Y., Sánchez-Olea R., Calera M.R. FEBS Lett. (0014-5793) Only protein-protein interactions gpn1_human GPN-loop GTPase 1 XAB1 XPA-binding protein 1 MBD2-interacting protein GPN1 MBDIN HUSSY-23 RNAPII-associated protein 4 RPAP4 protein protein human Homo sapiens Human MAASAAAAELQASGGPRHPVCLLVLGMAGSGKTTFVQRLTGHLHAQGTPPYVINLDPAVHEVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKYVLIDTPGQIEVFTWSASGTIITEALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK gpn3_human GPN-loop GTPase 3 ATPBD1C ATP-binding domain 1 family member C GPN3 AD-009 UNQ1876/PRO4319 protein protein human Homo sapiens Human MPRYAQLVMGPAGSGKSTYCATMVQHCEALNRSVQVVNLDPAAEHFNYSVMADIRELIEVDDVMEDDSLRFGPNGGLVFCMEYFANNFDWLENCLGHVEDDYILFDCPGQIELYTHLPVMKQLVQQLEQWEFRVCGVFLVDSQFMVESFKFISGILAALSAMISLEIPQVNIMTKMDLLSKKAKKEIEKFLDPDMYSLLEDSTSDLRSKKFKKLTKAICGLIDDYSMVRFLPYDQSDEESMNIVLQHIDFAIQYGEDLEFKEPKEREDESSSMFDEYFQECQDE gpn3-gpn1 1566302 n/a 1566304 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1566305 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4a Gpn3-EYFP coexpressed with Gpn1-Flag displayed a cytoplasmic localization for the 24h that lasted this experiment, in contrast with the nuclear localization of Gpn3-EYFP when expressed alone (Fig 1A), which suggests that Gpn3-EYFP remained associated with Gpn1-Flag at all times (see Fig 4). More importantly, these results indicate that the mobilization of Gpn3-EYFP and Gpn1-Flag into the cell nucleus observed in the presence of LMB very likely occurs as a Gpn3-EYFP/Gpn1-Flag single protein complex. At the single cell level the nuclear accumulation of Gpn3- EYFP in the presence of LMB was always associated with nuclear Gpn1-Flag (Fig. 3A), supporting the proposal that the mobilization of Gpn3-EYFP and Gpn1-Flag occurs as a single complex. gpn1-gpn3-2 1566302 n/a 1566305 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed fixed cell fixed cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1566304 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4b Gpn3-EYFP coexpressed with Gpn1-Flag displayed a cytoplasmic localization for the 24h that lasted this experiment, in contrast with the nuclear localization of Gpn3-EYFP when expressed alone (Fig 1A), which suggests that Gpn3-EYFP remained associated with Gpn1-Flag at all times (see Fig 4). More importantly, these results indicate that the mobilization of Gpn3-EYFP and Gpn1-Flag into the cell nucleus observed in the presence of LMB very likely occurs as a Gpn3-EYFP/Gpn1-Flag single protein complex. At the single cell level the nuclear accumulation of Gpn3- EYFP in the presence of LMB was always associated with nuclear Gpn1-Flag (Fig. 3A), supporting the proposal that the mobilization of Gpn3-EYFP and Gpn1-Flag occurs as a single complex. gpn1-gpn3-3 1566303 n/a 1566304 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1566305 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f3a Gpn3-EYFP coexpressed with Gpn1-Flag displayed a cytoplasmic localization for the 24h that lasted this experiment, in contrast with the nuclear localization of Gpn3-EYFP when expressed alone (Fig 1A), which suggests that Gpn3-EYFP remained associated with Gpn1-Flag at all times (see Fig 4). More importantly, these results indicate that the mobilization of Gpn3-EYFP and Gpn1-Flag into the cell nucleus observed in the presence of LMB very likely occurs as a Gpn3-EYFP/Gpn1-Flag single protein complex. At the single cell level the nuclear accumulation of Gpn3- EYFP in the presence of LMB was always associated with nuclear Gpn1-Flag (Fig. 3A), supporting the proposal that the mobilization of Gpn3-EYFP and Gpn1-Flag occurs as a single complex.