IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kong-2014-3 IRF4 is a key thermogenic transcriptional partner of PGC-1α. mouse-brown_adipose Mouse Brown Adipose Tissue brown_adipose Brown Adipose Tissue anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu Cell (0092-8674) 2014 Only protein-protein interactions imex curation kong-2014-1 IRF4 is a key thermogenic transcriptional partner of PGC-1α. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu Cell (0092-8674) 2014 Only protein-protein interactions imex curation kong-2014-2 IRF4 is a key thermogenic transcriptional partner of PGC-1α. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu Cell (0092-8674) 2014 Only protein-protein interactions imex curation kong-2014-4 IRF4 is a key thermogenic transcriptional partner of PGC-1α. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu Cell (0092-8674) 2014 Only protein-protein interactions imex curation kong-2014-5 IRF4 is a key thermogenic transcriptional partner of PGC-1α. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu Cell (0092-8674) 2014 Only protein-protein interactions imex curation kong-2014-6 IRF4 is a key thermogenic transcriptional partner of PGC-1α. mouse-brown_adipose Mouse Brown Adipose Tissue brown_adipose Brown Adipose Tissue ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu Cell (0092-8674) 2014 Only protein-protein interactions imex curation prgc1_mouse Peroxisome proliferator-activated receptor gamma coactivator 1-alpha Ppargc1a Pgc1 Pgc1a Ppargc1 protein protein mouse Mus musculus Mouse MAWDMCSQDSVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQSEIISNQYNNEPANIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGAVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHAANHTHRIRTNPAIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCASKKKSHTQPQSQHAQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTPPHKANQDNPFKASPKLKPSCKTVVPPPTKRARYSECSGTQGSHSTKKGPEQSELYAQLSKSSGLSRGHEERKTKRPSLRLFGDHDYCQSLNSKTDILINISQELQDSRQLDFKDASCDWQGHICSSTDSGQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGLAMDGLFDDSEDESDKLSYPWDGTQPYSLFDVSPSCSSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSCYYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEAYEHERLKRDEYRKEHEKRESERAKQRERQKQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR irf4_mouse Interferon regulatory factor 4 Irf4 Spip Lymphocyte-specific interferon regulatory factor NF-EM5 PU.1 interaction partner Transcriptional activator PIP protein protein mouse Mus musculus Mouse MNLETGSRGSEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSVFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLDDTQMAMGHPYPMTAPYGSLPAQQVHNYMMPPHDRSWRDYAPDQSHPEIPYQCPVTFGPRGHHWQGPSCENGCQVTGTFYACAPPESQAPGIPIEPSIRSAEALALSDCRLHICLYYRDILVKELTTTSPEGCRISHGHTYDVSNLDQVLFPYPDDNGQRKNIEKLLSHLERGLVLWMAPDGLYAKRLCQSRIYWDGPLALCSDRPNKLERDQTCKLFDTQQFLSELQVFAHHGRPAPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNTGHFLRGYELPEHVTTPDYHRSLRHSSIQE ucp1_mouse_gene Mitochondrial brown fat uncoupling protein 1 gene gene mouse Mus musculus Mouse irf4-ppargc1a-1 1573256 n/a 1573262 unspecified role unspecified role prey prey n/a 1573263 unspecified role unspecified role bait bait physical association physical association false false false Fig. 7B ppargc1a-irf4-1 1573256 n/a 1573262 unspecified role unspecified role bait bait n/a 1573263 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7B irf4-ppargc1a 1573257 n/a 1573262 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1573263 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false Fig. 7A, Sup. Fig. 7D, 7E ppargc1a-irf4 1573258 n/a 1573262 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1573263 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false Fig. 7A ppargc1a-irf4-3 1573259 n/a 1573262 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1573263 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection smad_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 7G ppargc1a-irf4-2 1573260 n/a 1573262 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1573263 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection in vitro In vitro physical association physical association false false false 7C irf4-ucp1 1573261 n/a 1573263 unspecified role unspecified role bait bait n/a 1573264 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7E Q64287 increases expression at protein level of ENSMUSG00000031710