IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wan-2014-1 MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation wan-2014-2 MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer Lysates from Mtdh−/− Mouse mammary epithelial cells, carrying a transgene containing the Mouse mammary tumor virus (MMTV) long terminal repeat (promoter/enhancer) and the Polyoma Virus middle T antigen (the oncogene). The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation wan-2014-3 MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation wan-2014-4 MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. mouse-4t1 4T1 Mouse metastatic mammary carcinoma cell line 4t1 4T1 Mouse metastatic mammary carcinoma cell line http://www.lgcstandards-atcc.org/products/all/CRL-2539.aspx?geo_country=gb anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation wan-2014-5 MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. mouse-breast_luminal_adenocarcinoma MOUSE breast luminal adenocarcinoma breast_luminal_adenocarcinoma breast luminal adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer Lysates from Mtdh+/+ Mouse mammary tumor cells, carrying a transgene containing the Mouse mammary tumor virus (MMTV) long terminal repeat (promoter/enhancer) and the Polyoma Virus middle T antigen (the oncogene). The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation wan-2014-6 MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. mouse-breast_luminal_adenocarcinoma MOUSE breast luminal adenocarcinoma breast_luminal_adenocarcinoma breast luminal adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer Lysates from Mtdh+/+ (and Mtdh-/-) Mouse mammary tumor cells, carrying a transgene containing the Mouse mammary tumor virus (MMTV) long terminal repeat (promoter/enhancer) and the Polyoma Virus middle T antigen (the oncogene). The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation wan-2014-7 MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation ago2_human Protein argonaute-2 AGO2 Argonaute RISC catalytic component 2 EIF2C2 Eukaryotic translation initiation factor 2C 2 PAZ Piwi domain protein Protein slicer protein protein human Homo sapiens Human MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA lyric_human Protein LYRIC Lysine-rich CEACAM1 co-isolated protein 3D3/LYRIC Metastasis adhesion protein Astrocyte elevated gene-1 protein MTDH AEG1 LYRIC Metadherin protein protein human Homo sapiens Human MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYGWAAACAGARKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEAVRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAGEEKWNSVSPASAGKRKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQDTEELEKEIREDLPVNTSKTRPKQEKAFSLKTISTSDPAEVLVKNSQPIKTLPPATSTEPSVILSKSDSDKSSSQVPPILQETDKSKSNTKQNSVPPSQTKSETSWESPKQIKKKKKARRET snd1_human Staphylococcal nuclease domain-containing protein 1 100 kDa coactivator EBNA2 coactivator p100 Tudor domain-containing protein 11 SND1 p100 co-activator TDRD11 protein protein human Homo sapiens Human MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNGENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAHYEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHVTLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDADEFGYSR lyric_mouse Protein LYRIC Lysine-rich CEACAM1 co-isolated protein 3D3/LYRIC Metastasis adhesion protein Mtdh Lyric Metadherin protein protein mouse Mus musculus Mouse MAARSWQDELAQQAEEGSARLRELLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYGWAAACAGARKKRRSPPRKREEAAPPTPAPDDLAQLKNLRSEEQKKKNRKKLPEKPKPNGRTVEVPEDEVVRNPRSITAKQAPETDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENIITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSRLNENLTVNGGGWSEKSVKLSSQLSEEKWNSVPPASAGKRKTEPSAWTQDTGDTNANGKDWGRNWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPSSDWNAPAEEWGNWVDEDRASLLKSQEPISNDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSHTQDTEDLEKDTREELPVNTSKARPKQEKACSLKTMSTSDPAEVLIKNSQPVKTLPPAISAEPSITLSKGDSDNSSSQVPPMLQDTDKPKSNAKQNSVPPSQTKSETNWESPKQIKKKKKARRET snd1_mouse Staphylococcal nuclease domain-containing protein 1 p100 co-activator 100 kDa coactivator Snd1 protein protein mouse Mus musculus Mouse MASSAQSSGSSGGPAVPTVQRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDGKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNGENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPGHHLVTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNLLGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVPPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGDNIQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHMDGANLSVLLVEQALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWAHYEERPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDISSHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGTLPPAFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSASCPHVTLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDADEFGYSR mtdh-ago2-2 1562811 n/a 1562818 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1562819 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1562820 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5Di mtdh-ago2-1 1562811 n/a 1562818 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1562819 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q86UE4:p.[Asp389Arg;Asp393_Trp394delinsArgAsp] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5Dii SND1-binding deficient TPM1 and TPM2 MTDH were still able to interact with AGO2. mtdh-mtdh-1 1562811 n/a 1562819 unspecified role unspecified role bait bait Q86UE4:p.Trp394Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q86UE4:p.Trp401Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q86UE4:p.[Asp389Arg;Asp393_Trp394delinsArgAsp] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q86UE4:p.Glu399_Trp401delinsArgArgAsp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false n/a 1562820 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5 D/E mtdh-ago2-3 1562811 N/A 1562818 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1562819 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q86UE4:p.Glu399_Trp401delinsArgArgAsp mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5Dtpm2 SND1-binding deficient TPM1 and TPM2 MTDH were still able to interact with AGO2. mtdh-snd1 1562812 n/a 1562821 unspecified role unspecified role bait bait Q80WJ7:p.Trp391Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q80WJ7:p.[Asp386Arg;Asp390_Trp391delinsArgAsp] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q80WJ7:p.Glu396_Trp398delinsArgArgAsp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q80WJ7:p.Trp398Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false n/a 1562822 unspecified role unspecified role prey prey physical association physical association false false false 6 A/E mtdh-snd1-4 1562813 n/a 1562819 unspecified role unspecified role bait bait n/a 1562820 unspecified role unspecified role prey prey physical association physical association false false false Supp 4A mtdh-snd1-1 1562814 n/a 1562821 unspecified role unspecified role bait bait n/a 1562822 unspecified role unspecified role prey prey physical association physical association false false false Supp 4B snd1-mtdh-1 1562815 n/a 1562822 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1562821 unspecified role unspecified role prey prey physical association physical association false false false Supp 4C mtdh-snd1-2 1562816 n/a 1562821 unspecified role unspecified role bait bait n/a 1562822 unspecified role unspecified role prey prey physical association physical association false false false Supp 4D When tumours from Lyric knockout mice were IP-ed, Snd1 was not precipitated. mtdh-snd1-3 1562817 n/a 1562819 unspecified role unspecified role bait bait Q86UE4:p.Glu399_Trp401delinsArgArgAsp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q86UE4:p.[Asp389Arg;Asp393_Trp394delinsArgAsp] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false subregion from lung-homing for mammary tumors region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1562820 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 5B/C