MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014m-1 Reactivation of oxidized PTP1B and PTEN by Thioredoxin 1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot tonks@cshl.edu 2014 imex curation Schwertassek U., Haque A., Krishnan N., Greiner R., Weingarten L., Dick T.P., Tonks N.K. FEBS J. (1742-464X) Only protein-protein interactions thio_human Thioredoxin ATL-derived factor Surface-associated sulphydryl protein TXN TRDX TRX TRX1 protein protein human Homo sapiens Human MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV ptn1_human Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B protein protein human Homo sapiens Human MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT ptpn1-txn 1554343 n/a TRX1 1554344 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell cys35ser trap-mutant trapping mutant trap-mutant certain certain sequence position certain certain certain sequence position certain false tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a PTP1B 1554345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P18031:p.Cys215_Ser216delinsAlaAla mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5 As expected, exogenously applied H2O2 induced disulfide bond formation between PTP1B and the TRX1 trapping mutant (TRX1-C35S) (Figure 5A). To confirm that the catalytic cysteine of PTP1B is essential for disulfide bond formation with TRX1, we used a PTP1B mutant that lacks the catalytic cysteine, but adopts the conformation of the oxidized protein in a stable manner (PTP1B-CASA) [16]. Indeed, PTB1B-CASA failed to form a conjugate with TRX1-C35S (Figure 5B). Using this approach, we also detected TRX1(C35S)- PTP1B complex formation following stimulation of the cells with a physiological trigger, in this case insulin (Figure 5C). Again, conjugation depended on the catalytic cysteine of PTP1B (Figure 5D). ptpn1-txn-1 1554343 n/a PTP1B 1554345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P18031:p.Cys215_Ser216delinsAlaAla mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a TRX1 1554344 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell cys35ser trap-mutant trapping mutant trap-mutant certain certain sequence position certain certain certain sequence position certain false tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5 As expected, exogenously applied H2O2 induced disulfide bond formation between PTP1B and the TRX1 trapping mutant (TRX1-C35S) (Figure 5A). To confirm that the catalytic cysteine of PTP1B is essential for disulfide bond formation with TRX1, we used a PTP1B mutant that lacks the catalytic cysteine, but adopts the conformation of the oxidized protein in a stable manner (PTP1B-CASA) [16]. Indeed, PTB1B-CASA failed to form a conjugate with TRX1-C35S (Figure 5B). Using this approach, we also detected TRX1(C35S)- PTP1B complex formation following stimulation of the cells with a physiological trigger, in this case insulin (Figure 5C). Again, conjugation depended on the catalytic cysteine of PTP1B (Figure 5D).