IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kirschke-2014-2 Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. agard@msg.ucsf.edu Cell (0092-8674) 2014 Only protein-protein interactions imex curation kirschke-2014-1 Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. agard@msg.ucsf.edu Cell (0092-8674) 2014 Only protein-protein interactions imex curation kirschke-2014-4 Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Protein identities confirmed by both light scattering and comassie staining in an SDS gel. agard@msg.ucsf.edu Cell (0092-8674) 2014 Only protein-protein interactions imex curation kirschke-2014-6 Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Protein fractions from a gel filtration column crosslinked with 0.02% glutaraldehyde comassie staining in an SDS gel. agard@msg.ucsf.edu Cell (0092-8674) 2014 Only protein-protein interactions imex curation kirschke-2014-3 Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. in vitro In vitro h1-h2 ms mass spectrometry study of hydrogen/deuterium exchange h1-h2 ms ms participant Identification by mass spectrometry ms participant Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. agard@msg.ucsf.edu Cell (0092-8674) 2014 Only protein-protein interactions imex curation kirschke-2014-5 Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Protein identities confirmed by both light scattering and comassie staining in an SDS gel. agard@msg.ucsf.edu Cell (0092-8674) 2014 Only protein-protein interactions imex curation gcr_human Glucocorticoid receptor Nuclear receptor subfamily 3 group C member 1 NR3C1 GRL protein protein human Homo sapiens Human MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK mas5_yeast Mitochondrial protein import protein MAS5 YDJ1 MAS5 YNL064C N2418 YNL2418C Yeast dnaJ protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKFPENHFTSEENLKKLEEILPPRIVPAIPKKATVDECVLADFDPAKYNRTRASRGGANYDSDEEEQGGEGVQCASQ E4539F3618DD9CF2 hsp71_human Heat shock 70 kDa protein 1A/1B HSPA1A HSPA1 HSPA1B Heat shock 70 kDa protein 1/2 HSX70 protein protein human Homo sapiens Human MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD stip1_human Stress-induced-phosphoprotein 1 Hsc70/Hsp90-organizing protein STIP1 Transformation-sensitive protein IEF SSP 3521 Renal carcinoma antigen NY-REN-11 protein protein human Homo sapiens Human MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR hs90a_human Heat shock protein HSP 90-alpha HSP90AA1 HSP90A HSPC1 Heat shock 86 kDa Renal carcinoma antigen NY-REN-38 HSPCA Lipopolysaccharide-associated protein 2 protein protein human Homo sapiens Human MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD tebp_human Prostaglandin E synthase 3 Cytosolic prostaglandin E2 synthase Telomerase-binding protein p23 Progesterone receptor complex p23 PTGES3 P23 TEBP Hsp90 co-chaperone protein protein human Homo sapiens Human MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE dexamethasone (8S,9R,10S,11S,13S,14S,16R,17R)-9- Fluoro-11,17-dihydroxy-17-(2-hydroxyacetyl)-10,13,16- trimethyl-6,7,8,9,10,11,12,13,14,15,16,17- dodecahydro-3H-cyclopenta[a]phenanthren-3-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) nr3c1-hspa1a 1566868 n/a 1566874 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1566875 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1566876 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association false false false 1566868 Supp. Fig. 1D, Supp Fig. 3 Bag1 nr3c1-hsp90aa1 1566868 n/a 1566874 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1566877 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1566878 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1566876 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1566875 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association false false false 1566868 Supp Fig. 3 nr3c1-hsp90aa1-1 1566868 n/a 1566874 unspecified role unspecified role bait bait P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1566875 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1566878 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1566876 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1566879 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association false false false 1566868 Supp Fig. 3 17AAG (a specific Hsp90 inhibitor), HSP90 Glu47Ala and Asp93Asn mutants caused a significant loss in PTGES3 binding to the GR complex. nr3c1-hsp90aa1-2 1566868 n/a 1566874 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1566877 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1566876 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1566878 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1566875 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1566879 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association false false false 1566868 Supp Fig. 3 dexamethasone-nr3c1-2 1566869 n/a 1566874 unspecified role unspecified role neutral component neutral component lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1566880 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 1566869 Fig. 1, 4C Supp. Fig. 1 No enhancement in ligand binding by Hsp90 was detected. dexamethasone-nr3c1-3 1566869 n/a 1566874 unspecified role unspecified role neutral component neutral component n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1566880 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 1566869 Supp. Fig. 1 dexamethasone-hspa1a 1566869 n/a 1566874 unspecified role unspecified role neutral component neutral component P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1566876 inhibitor inhibitor neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1566880 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1566875 inhibitor inhibitor neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 2A, 2C, 4C-H, Supp. Fig. 1C, 1E Inhibition of dexamethsone binding is ATP dependant. Significant recovery from inhbition by Hsp40/70 occurred with Hsp90 (P07900 ) and either STIP1/Hop (P31948) or PTGES3 (Q15185). This recovery is inhibited by the HSP90 inhibitor 17AAG. The Hsp90 concentration dependence of recovery saturates at stoichiometric amounts of Hsp90 dimer and GR and mutant studies indicate that both nucleotide binding and hydrolysis are required to reverse Hsp70 inhibition. The concentration dependence of Hsp70 shows a cooperative mode of inhibition with a half-maximal inhibitory concentration (IC50) of 4.6 +/- 0.6 μM and a Hill coefficient of 1.6 +/- 0.6. The F602S mutation had no effect on the IC50. hsp90aa1-hspa1a 1566870 n/a 1566877 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1566878 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1566876 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection Stoichiometry: 1.0 physical association physical association false false false 1566870 Supp Fig. 5A-B hsp90aa1-hspa1a-1 1566870 n/a 1566874 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1566878 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1566877 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1566876 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection Stoichiometry: 1.0 physical association physical association false false false 1566870 Supp Fig. 5A-C hsp90aa1-hspa1a-2 1566871 n/a 1566878 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1566877 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1566876 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection Stoichiometry: 1.0 physical association physical association false false false Supp Fig. 5A-B hsp90aa1-hspa1a-2 1566871 n/a 1566874 unspecified role unspecified role neutral component neutral component lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1566878 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1566876 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection Stoichiometry: 1.0 n/a 1566877 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Supp Fig. 5A-C nr3c1-hspa1a-1 1566872 n/a 1566874 unspecified role unspecified role neutral component neutral component n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1566875 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1566876 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 3. Supp. Fig. 2C hsp90aa1-hspa1a-2 1566873 n/a 1566874 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1566878 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1566877 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1566876 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection Stoichiometry: 1.0 physical association physical association false false false 1566873 Fig. 5, Supp Fig. 5D, 5E, 6 38A