MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lytovchenko-2014-5 The INA complex facilitates assembly of the peripheral stalk of the mitochondrial F1Fo-ATP synthase. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lytovchenko O., Naumenko N., Oeljeklaus S., Schmidt B., von der Malsburg K., Deckers M., Warscheid B., van der Laan M., Rehling P. peter.rehling@medizin.uni-goettingen.de; martin.van.der.laan@biochemie.uni-freiburg.de peter.rehling@medizin.uni-goettingen.de,martin.van.der.laan@biochemie.uni-freiburg.de EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation lytovchenko-2014-1 The INA complex facilitates assembly of the peripheral stalk of the mitochondrial F1Fo-ATP synthase. yeast Saccharomyces cerevisiae Baker's yeast pull down pull down ms participant Identification by mass spectrometry ms participant Lytovchenko O., Naumenko N., Oeljeklaus S., Schmidt B., von der Malsburg K., Deckers M., Warscheid B., van der Laan M., Rehling P. peter.rehling@medizin.uni-goettingen.de; martin.van.der.laan@biochemie.uni-freiburg.de peter.rehling@medizin.uni-goettingen.de,martin.van.der.laan@biochemie.uni-freiburg.de EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation lytovchenko-2014-2 The INA complex facilitates assembly of the peripheral stalk of the mitochondrial F1Fo-ATP synthase. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lytovchenko O., Naumenko N., Oeljeklaus S., Schmidt B., von der Malsburg K., Deckers M., Warscheid B., van der Laan M., Rehling P. peter.rehling@medizin.uni-goettingen.de; martin.van.der.laan@biochemie.uni-freiburg.de peter.rehling@medizin.uni-goettingen.de,martin.van.der.laan@biochemie.uni-freiburg.de EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation lytovchenko-2014-3 The INA complex facilitates assembly of the peripheral stalk of the mitochondrial F1Fo-ATP synthase. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lytovchenko O., Naumenko N., Oeljeklaus S., Schmidt B., von der Malsburg K., Deckers M., Warscheid B., van der Laan M., Rehling P. peter.rehling@medizin.uni-goettingen.de; martin.van.der.laan@biochemie.uni-freiburg.de peter.rehling@medizin.uni-goettingen.de,martin.van.der.laan@biochemie.uni-freiburg.de EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation lytovchenko-2014-4 The INA complex facilitates assembly of the peripheral stalk of the mitochondrial F1Fo-ATP synthase. in vitro In vitro pull down pull down autoradiography autoradiography Lytovchenko O., Naumenko N., Oeljeklaus S., Schmidt B., von der Malsburg K., Deckers M., Warscheid B., van der Laan M., Rehling P. peter.rehling@medizin.uni-goettingen.de; martin.van.der.laan@biochemie.uni-freiburg.de peter.rehling@medizin.uni-goettingen.de,martin.van.der.laan@biochemie.uni-freiburg.de EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation ina17_yeast Inner membrane assembly complex subunit 17 INA17 AIM43 Altered inheritance of mitochondria protein 43 FMP14 Found in mitochondrial proteome protein 14 INA complex 17 kDa subunit YPL099C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLKRRSNALITLSRTKLFPITTVAYYHRRLLNQQRRAVSTSPKKEIKSLEDLANLDSLDGVDTELIRDLINEHTTKLNIKKELDMLKKFSQEEESGHEIPVKRFIRPLWMFILMGSSVYLLLHFSWWKLEHEERESQLKKEVEILEHQLNELIVQDKTHNTSRGKGSNESTHMKPWYRRWFW mint atpo_yeast ATP synthase subunit 5, mitochondrial Oligomycin sensitivity conferral protein ATP5 YDR298C OSCP D9740.11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNRVFTRSFASSLRAAASKAAAPPPVRLFGVEGTYATALYQAAAKNSSIDAAFQSLQKVESTVKKNPKLGHLLLNPALSLKDRNSVIDAIVETHKNLDGYVVNLLKVLSENNRLGCFEKIASDFGVLNDAHNGLLKGTVTSAEPLDPKSFKRIEKALSASKLVGQGKSLKLENVVKPEIKGGLIVELGDKTVDLSISTKIQKLNKVLEDSI BD5F8EF4503E4D66 atpb_yeast ATP synthase subunit beta, mitochondrial ATP2 J2041 YJR121W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLPRLYTATSRAAFKAAKQSAPLLSTSWKRCMASAAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLAAEAN EDFF256826F68F0C atpa_yeast ATP synthase subunit alpha, mitochondrial ATP1 YBL0827 YBL099W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLARTAAIRSLSRTLINSTKAARPAAAALASTRRLASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF E8041D289B924696 ina22_yeast Inner membrane assembly complex subunit 22 INA22 INA complex 22 kDa subunit YIR024C protein protein yeast Saccharomyces cerevisiae Baker's yeast MFMARQVLRNGLFLRSLAPIKITARTVASANAGIKRKSRFDKTMIKPLLLVMIFGSILNAVIAEKRNIIDMERKYKLKLDKLKELIRRVHDNNGKVDFDADDELKLVNLRLGIVGKNATGMKEDETDIVVPKEESLEEIWQSIIDEAKKEVIEKTPDAGVKNKEGIVTDLNVLKDLEKSKKEDEKVYLSGDVHMMMNQPGDLNEIAKEHDKIPKFL atpd_yeast ATP synthase subunit delta, mitochondrial ATP16 YDL004W YD8119.03 D2935 F-ATPase delta subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRSIIGKSASRSLNFVAKRSYAEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPDSQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK mint Mitochondrial membrane ATP synthase (F(1)F(O) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits cbp6_yeast Cytochrome B pre-mRNA-processing protein 6 YBR0916 YBR120C CBP6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSQVVRDSAKKLVNLLEKYPKDRIHHLVSFRDVQIARFRRVAGLPNVDDKGKSIKEKKPSLDEIKSIINRTSGPLGLNKEMLTKIQNKMVDEKFTEESINEQIRALSTIMNNKFRNYYDIGDKLYKPAGNPQYYQRLINAVDGKKKESLFTAMRTVLFGK C8F5D171CDF7DD70 atp7_yeast ATP synthase subunit d, mitochondrial ATP7 YKL016C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLAKSAANKLDWAKVISSLRITGSTATQLSSFKKRNDEARRQLLELQSQPTEVDFSHYRSVLKNTSVIDKIESYVKQYKPVKIDASKQLQVIESFEKHAMTNAKETESLVSKELKDLQSTLDNIQSARPFDELTVDDLTKIKPEIDAKVEEMVKKGKWDVPGYKDRFGNLNVM C6420CBEDF1BB45E atpf_yeast ATP synthase subunit 4, mitochondrial ATP4 LPF7C YPL078C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSMSMGVRGLALRSVSKTLFSQGVRCPSMVIGARYMSSTPEKQTDPKAKANSIINAIPGNNILTKTGVLGTSAAAVIYAISNELYVINDESILLLTFLGFTGLVAKYLAPAYKDFADARMKKVSDVLNASRNKHVEAVKDRIDSVSQLQNVAETTKVLFDVSKETVELESEAFELKQKVELAHEAKAVLDSWVRYEASLRQLEQRQLAKSVISRVQSELGNPKFQEKVLQQSISEIEQLLSKLK BDBE0F6AD6E5392C cbp4_yeast Assembly factor CBP4 CBP4 YGR174C Cytochrome b mRNA-processing protein 4 G7122 protein protein yeast Saccharomyces cerevisiae Baker's yeast MERPLWVRWLKVYAIGGAIIGSGFLLFKYTTPTDQQLISQLSPELRLQYEREKKLRQSEQQALMKIVKETSQSDDPIWKTGPLQSPWERNGDNVQSRDHFAKVRAEEVQKEELARIRNELSQLRSETEEKTKEIVQDKQVKSWWRFW cbp3_yeast Protein CBP3, mitochondrial P1775 YPL215W CBP3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MMSVNRFTSGRLPVFLRKSPFYYSRAYLHQTCVFKQNKETAQDSPELLAKSSHLNSKPLDVSNKAPVKTAQNKIPLAHSKYESSKYELPKWKEALGELVIRAFHLDMDRVRAGPVAGSYYYKICKEQGLQYEDEPLSETAKYFYEDLKLPRTFSQWFQITVLHEWILFVRMRAMPFKYGRNYQQKLVDRTFSDIELRLFEEMKVNSGRIADQYLKDFNTQLRGAIFAYDEGFATDDGTLATAVWRNLFGGRKNIDMVHLESVVRYIYSQLYVLSRLSDREFATGKFKFVPPGVKVEKLTPKQEEELKAKTIAKYEALDKDPKTLPSERSRLSYTN 9384CBD3E083F6B9 atpg_yeast ATP synthase subunit gamma, mitochondrial ATP3 YBR039W YBR0408 F-ATPase gamma subunit ATP3a ATP3b protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSRIVSNNATRSVMCHQAQVGILYKTNPVRTYATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSDKGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYPKISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG ADC71F3C1E0CDF91 coa3_yeast Cytochrome c oxidase assembly factor 3, mitochondrial COA3 COX25 RRG10 Required for respiratory growth protein 10 YJL062W-A Cytochrome c oxidase protein 25 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLNPSKYQDTRTWKMTPAMIRARKPFFKGNMLGLTLLLGVTGSVYYYTYHFLHKDNDFADVPIPPIDPQELEALKKEYEAKKKA mss51_yeast Protein MSS51, mitochondrial MSS51 YLR203C L8167.17 Mitochondrial splicing suppressor protein 51 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKRQ aim43-atp1-1 1598850 n/a 1598855 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed prota tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1598856 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598857 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598858 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f6f f6g aim43-atp1-2 1598850 n/a 1598856 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598858 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598857 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598859 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed prota tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false f6g aim43-yiu4 1598850 n/a 1598855 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598859 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f6c yiu4-atp1 1598851 n/a 1598858 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598859 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed prota tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1598857 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f3a yiu4-aim43 1598851 n/a 1598860 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598855 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598859 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed prota tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1598858 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598857 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598861 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598862 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598863 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598864 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598865 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598866 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598856 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f3b st2 aim43-atp1 1598852 n/a 1598855 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598857 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598858 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598859 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level prota tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1598865 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598856 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f3d aim43-atp2-1 1598852 n/a 1598855 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed prota tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1598857 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false sf4b coa3-mss51 1598853 n/a 1598867 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1598868 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false sf4a yiu4-aim43-1 1598854 n/a 1598855 autoradiography autoradiography unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1598859 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f6d