MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014t-1 Arabidopsis thaliana plastoglobule-associated fibrillin 1a interacts with fibrillin 1b in vivo yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined angel.merida@csic.es 2014 imex curation Gámez-Arjona F.M., Concepción J.C., Raynaud S., Mérida A. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014b-2 Arabidopsis thaliana plastoglobule-associated fibrillin 1a interacts with fibrillin 1b in vivo nicbe-leaf Nicotiana benthamiana leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence angel.merida@csic.es 2014 imex curation Gámez-Arjona F.M., Concepción J.C., Raynaud S., Mérida A. FEBS Lett. (0014-5793) Only protein-protein interactions pap2_arath Probable plastid-lipid-associated protein 2, chloroplastic PAP2 FBN1b FIB1b Fibrillin-1b T10I14.70 At4g22240 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATVQLSTQFSCQTRVSISPNSKSISKPPFLVPVTSIIHRPMISTGGIAVSPRRVFKVRATDTGEIGSALLAAEEAIEDVEETERLKRSLVDSLYGTDRGLSASSETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILAYTSFVNLFPLLSRGIVPLIKVDEISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSIEIPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPADNAQSWLLTTYLDKDIRISRGDGGSVFVLIKEGSPLLNP pap1_arath Probable plastid-lipid-associated protein 1, chloroplastic PAP1 FBN1a FIB1a Fibrillin-1a PGL35 Plastoglobulin 35 T24H24.16 At4g04020 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATVPLFTQFPCKTLNPSSSNTKHQSKSPILLPINSINRRSEIGVSVHRPDFKIRATDIDDEWGQDGVERVFASSSTVSVADKAIESVEETERLKRSLADSLYGTDRGLSVSSDTRAEISELITQLESKNPTPAPNEALFLLNGKWILAYTSFVGLFPLLSRRIEPLVKVDEISQTIDSDSFTVQNSVRFAGPFSTTSFSTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSIEIPESVEVLGQKIDLNPIKGLLTSVQDTASSVARTISNQPPLKFSLPSDNTQSWLLTTYLDKDLRISRGDGGSVYVLIKEGSSLLNP rk22_arath 50S ribosomal protein L22, chloroplastic rpl22 AtCg00810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIKKRKKKSYTEVYALGQYISMSAHKARRVIDQIRGRSYEEALMILELMPYRGCYPIFKLVYSAAANASHNKGFKETNLVISKAEVNQGNTVKKLKPRARGRSYPIKRSTCHITIVLEDISFYQQYEEYLMYLKKPGCSNENRNLTCYDTYSSGGLWDKK atpg1_arath ATP synthase gamma chain 1, chloroplastic ATPC1 F-ATPase gamma subunit 1 T19J18.4 At4g04640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MACSNLTTMWVSSKPSLSADSSSLSFRSVLKCPTNTSSPPSRASSVSPLQASLRELRDRIDSVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSETLVEVLYNINEQLQTDDVDVPLTKVRPVKKVALVVVTGDRGLCGGFNNFIIKKAEARIKELKGLGLEYTVISVGKKGNSYFLRRPYIPVDKYLEAGTLPTAKEAQAVADDVFSLFISEEVDKVELLYTKFVSLVKSEPVIHTLLPLSPKGEICDINGTCVDAAEDEFFRLTTKEGKLTVERETFRTPTADFSPILQFEQDPVQILDALLPLYLNSQILRALQESLASELAARMSAMSSASDNASDLKKSLSMVYNRKRQAKITGEILEIVAGANAQV rpi3_arath Probable ribose-5-phosphate isomerase 3, chloroplastic RPI3 EMB3119 Phosphoriboisomerase 3 Protein EMBRYO DEFECTIVE 3119 F7O18.28 T9J14.26 At3g04790 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASLSFVSSSHLTLRTPSIALRSTGSSPRTSVSFSVKAQSVALSQDDLKKLAAEKAVEAIKPGMVLGLGTGSTAAFAVDQIGKLLSSGELYDIVGIPTSKRTEEQARSLGIPLVGLDTHPRIDLAIDGADEVDPNLDLVKGRGGALLREKMVEAVADKFIVVADDTKLVTGLGGSGLAMPVEVVQFCWNFNLIRLQDLFKEFGCESKLRVDGDGKPYVTDNSNYIIDLYFKTPLKDGFAAAKEIGKFQGVVEHGLFLGMATSVIIAGKNGVEVMTK pap1-pap2 1545782 n/a FBN1b 1545784 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a FBN1a 1545785 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false t1 f3 pap2-pap1 1545782 n/a FBN1b 1545784 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a Ribosomal protein L22 1545786 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false t1 pap2-rpl22 1545782 n/a F-ATPase gamma subunit 1 1545787 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a FBN1b 1545784 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false t1 pap2-atpc1 1545782 n/a Ribose 5-P isomerase 1545788 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a FBN1b 1545784 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false t1 pap2-pap1-1 1545782 n/a FBN1b 1545784 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a FBN1b 1545784 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false t1 f3 pap2-pap1-2 1545783 n/a FBN1a 1545785 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a FBN1b 1545784 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2d f2e f2f pap1-pap2-1 1545783 n/a FBN1b 1545784 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a FBN1b 1545784 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2a f2b f2c f4