IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mohn-2014-2 The rhino-deadlock-cutoff complex licenses noncanonical transcription of dual-strand piRNA clusters in Drosophila. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay antibody detection identification by antibody antibody detection Mohn F., Sienski G., Handler D., Brennecke J. fabio.mohn@imba.oeaw.ac.at, julius.brennecke@imba.oeaw.ac.at Cell (0092-8674) 2014 Only protein-protein interactions imex curation mohn-2014-3 The rhino-deadlock-cutoff complex licenses noncanonical transcription of dual-strand piRNA clusters in Drosophila. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mohn F., Sienski G., Handler D., Brennecke J. fabio.mohn@imba.oeaw.ac.at, julius.brennecke@imba.oeaw.ac.at Cell (0092-8674) 2014 Only protein-protein interactions imex curation mohn-2014-4 The rhino-deadlock-cutoff complex licenses noncanonical transcription of dual-strand piRNA clusters in Drosophila. drome-nurse_cell Drosophila melanogaster nurse_cell Nurse cell confocal microscopy confocal microscopy immunostaining immunostaining Mohn F., Sienski G., Handler D., Brennecke J. fabio.mohn@imba.oeaw.ac.at, julius.brennecke@imba.oeaw.ac.at Cell (0092-8674) 2014 Only protein-protein interactions imex curation mohn-2014-1 The rhino-deadlock-cutoff complex licenses noncanonical transcription of dual-strand piRNA clusters in Drosophila. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Mohn F., Sienski G., Handler D., Brennecke J. fabio.mohn@imba.oeaw.ac.at, julius.brennecke@imba.oeaw.ac.at Cell (0092-8674) 2014 Only protein-protein interactions imex curation hp1_drome Heterochromatin protein 1 Su(var)205 HP1 CG8409 Non-histone chromosomal protein C1A9 antigen protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYEERLSWYSDNED h3_drome Histone H3 His3 His3:CG31613 His3:CG33857 His3:CG33860 His3:CG33863 His3:CG33866 CG31613 CG33803 CG33806 CG33809 CG33812 CG33815 CG33818 CG33821 CG33824 CG33827 CG33830 CG33833 CG33836 CG33839 CG33842 CG33845 CG33848 CG33851 CG33854 CG33857 CG33860 CG33863 CG33866 His3:CG33803 His3:CG33806 His3:CG33809 His3:CG33812 His3:CG33815 His3:CG33818 His3:CG33821 His3:CG33824 His3:CG33827 His3:CG33830 His3:CG33833 His3:CG33836 His3:CG33839 His3:CG33842 His3:CG33845 His3:CG33848 His3:CG33851 His3:CG33854 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA q7jxa8_drome rhi rhino hp1d Dmel\CG10683 HP1 HP1D HP1d RHI Rhi Rhino rno CG10683 Dmel_CG10683 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSRNHQRPNLGLVDAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKMNQKKGKNIKKTAGKIKDIENYPKTQMPSTSQVSTDSTEVFDGNPSATTTNMIKSPRIQSLFSDLNLIEPTKDKDVGDTSLKTPPKSRRLIEFPQREDAPLSSKHVSPMLIRKESQPLQSSCTDDSDLGESSSSMSLPTVSSTSSEKSIKVTKSEPKTLGQIKFSSRSSDGGHAASSLGAPKEGDIGLDLSGSDSMDSEVESMRRCPRRKRKKTYPDWKFPEMTKPFGVNRGLDLDKILHCYQMNDDLFMFVTWKGCSSIDAVHINDIKEAYPLQIIKYFESLRIIVPK del_drome Protein deadlock del CG9252 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEKLDKIRMSQKLSCWQHILTTLGTSSKTEQEWNTFFKGFLESWRKPYCIQTSCDPSIPLRKELLVRPRKALQENPHGPGSTLPESPVFLEPINSTAPREHPSPSKSHSTGSTGCDPGNGERSPSVSNKNSKYKNPGNSKYAKIWKRSNNHTTSIFSKAQISKRRDKLSSTKKRPDTCAPTDDSRKNREPRACAPNKNIFKTRETNAPNLTKNSCALPNVLILSPNSASKITQRGHSVGQTQDYKASPGKIIKRVPRYSLQCLKKKTEKVHNKIMDKPKNKQQPQTPPPFLLNNEYTESSDDSDDQLPLSELSQKMKSNKLNTLFLSRNEDCSPAPEKVKLKGERPAQNKKEQLTWEPSILTNLTDLGKQVAEPLRKSVKKSAKQQKPRVRAPPQGKKTLPQLQTGLKTQDKQSTHEMISEQAKTISEASGQQTSQVQSSLSPNNIRNNSVKLISAKTLMPAQRSQDYSPNKMQVGQPLGFAIELPSPVDGKEASVEIDTQLVHTSKFLENMTRPSTVEVHKFDLMDIFMGENEKLDYEYDDDDVLSVAASWNGLDDENVPEDEPRKEAKTAEQLPKPEPSTETLKPIEKENAQKMQSIKSFQIPKLNAKNLKTQPSVMRSIYENEELEKNKVLAKPAPPSLVHQPLAESNRNQRDEATAARRAKETFPVFAPLYRVAPESAATLVSANSQQVIPQVYFSTSNQDGVNWIKDVFGIRCMQSVDNKCISINCDHTMNSLGEVQKRLMRMDEDTLLSLYRQTIRSFFLFQTYYTSFVDIFKFRNLWQYLLIMLVDCRLYKSISAPLLAHVYEALSKCGMQKEAVKRIMEHVWLPCKAHKYRDLMLTTLNILSNANWEDYCDKLTQLDKDYNFEIPHKNLITILKSSVDCSDKFANALKLITLHPNSIRTNETIMSILSNASKSYSYMHNESASASQGPPGAASFLAPPAAIQPPHTTVPNFGYLPNPSFHYSNEYAINIHNFD cuff_drome Protein cutoff CG13190 cuff protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSNYTILNIRAHSWAEKDNLVFPTITKPVSNGWFAWSPIGQFEPNSQKVPYVVVPPSIKFPISLRYKDSPPKLEKKPNIFLDNMLQYIESSSYMYVMVRNNQQAQLNANIVCTSEVLELMMCAPYEKKTGWSLGVTRYRNTMYICRIDVEQPDPIDQDNLKRAMQEFWLRNLRTHCVFENGIKMHQHNQSSEEHLRFHGVFSFDLNGNRVLFDSPVLAEMPSTTLNGSALSWVDLQIRPMFMSRLDWPEHNRTEALKWWVKCFLLGIESLYIARRDENAHVHNIEKTLVRDLWKSCEKDWSPTVCANFMIYLLNCISQVMAPIDCPSTVYLFQFDASQGTVSYKGLRGRNQYTFVSDWFRMMLDDHTNDMCKTPNLQTMSSIV his3-su_var_205-7 1565401 n/a 1565405 unspecified role unspecified role prey prey chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1565406 unspecified role unspecified role bait bait region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false lys-10 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) 1565417 1565412 direct interaction direct interaction false false false Supp. Fig. 3B his3-su_rhi-1 1565401 n/a 1565406 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false lys-10 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1565407 unspecified role unspecified role prey prey chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig 3A, Supp. Fig. 3A his3-su_var_205-8 1565401 n/a 1565405 unspecified role unspecified role prey prey chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1565406 unspecified role unspecified role bait bait lys-10 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Supp. Fig. 3B his3-rhi-2 1565401 n/a 1565407 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1565406 unspecified role unspecified role bait bait lys-10 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Supp. Fig. 3B his3-rhi-1 1565401 n/a 1565407 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1565406 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false lys-10 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Supp. Fig. 3B del-rhi 1565402 n/a 1565407 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1565408 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1565454 1565452 physical association physical association false false false Fig. 4G, Supp. Fig. 4F del-cuff 1565402 n/a 1565409 unspecified role unspecified role prey prey n/a 1565408 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4G, Supp. Fig. 4F cuff-del 1565402 n/a 1565408 unspecified role unspecified role prey prey n/a 1565409 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4G rhi-del 1565402 n/a 1565408 unspecified role unspecified role prey prey n/a 1565407 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4G del-rhi-1 1565403 n/a 1565407 unspecified role unspecified role neutral component neutral component n/a 1565408 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 4A cuff-del-1 1565403 n/a 1565408 unspecified role unspecified role neutral component neutral component n/a 1565409 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 4A cuff-rhi-2 1565403 n/a 1565409 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1565407 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 4A his3-su_var_205-5 1565404 n/a 1565406 unspecified role unspecified role bait bait region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false lys-10 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1565405 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 1565484 1565480 direct interaction direct interaction false false false Fig3A, Supp. Fig. 3A his3-su_var_205-6 1565404 n/a 1565406 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false lys-10 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1565407 unspecified role unspecified role prey prey chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) 1565491 1565487 direct interaction direct interaction false false false Fig 3A, Supp. Fig. 3A