IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fantauzzo-2014-1 PI3K-mediated PDGFRα signaling regulates survival and proliferation in skeletal development through p53-dependent intracellular pathways. mouse-mesenchyme Mus musculus mesenchyme mesenchyme Mesenchyme anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fantauzzo K.A., Soriano P. 17-02-2014: Fantauzzo K. Department of Developmental and Regenerative Biology Icahn School of Medicine at Mount Sinai, New York Mouse embryonic palatal mesenchymal (MEPM) cells philippe.soriano@mssm.edu Genes Dev. (0890-9369) 2014 Only protein-protein interactions imex curation fantauzzo-2014-2 PI3K-mediated PDGFRα signaling regulates survival and proliferation in skeletal development through p53-dependent intracellular pathways. mouse-mesenchyme Mus musculus mesenchyme mesenchyme Mesenchyme ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Fantauzzo K.A., Soriano P. 17-02-2014: Fantauzzo K. Department of Developmental and Regenerative Biology Icahn School of Medicine at Mount Sinai, New York Mouse embryonic palatal mesenchymal (MEPM) cells. philippe.soriano@mssm.edu Genes Dev. (0890-9369) 2014 Only protein-protein interactions imex curation ybox1_mouse Y-box-binding protein 1 Y-box transcription factor CCAAT-binding transcription factor I subunit A Enhancer factor I subunit A DNA-binding protein B Ybx1 Msy1 Msy-1 Yb1 Nsep1 Nuclease-sensitive element-binding protein 1 protein protein mouse Mus musculus Mouse MSSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYARRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE p53_mouse Cellular tumor antigen p53 Tp53 P53 Trp53 Tumor suppressor p53 protein protein mouse Mus musculus Mouse MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD tp53_mouse_gene Mouse p53 gene gene gene mouse Mus musculus Mouse ybx1-tp53 1499185 n/a 1499187 unspecified role unspecified role bait bait n/a 1499188 unspecified role unspecified role prey prey physical association physical association false false false 6c PDGF-AA ybx1-tp53-1 1499186 n/a 1499189 unspecified role unspecified role prey prey promoter region 3 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1499187 unspecified role unspecified role bait bait association association false false false 6d PDGF-AA