MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014f-1 The X-ray crystal structure of Shewanella oneidensis OmcA reveals new insight at the microbemineral interface in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined d.richardson@uea.ac.uk 2014 imex curation Edwards M.J., Baiden N., Johs A., Tomanicek S.J., Liang L., Shi L., Fredrickson J.K., Zachara J.M., Gates A.J., Butt J.N., Richardson D.J., Clarke T.A. FEBS Lett. (0014-5793) Only protein-protein interactions q8eg33_sheon omcA SO_1779 protein protein sheon Shewanella oneidensis (strain MR-1) MMKRFNFNTATKAMLGAGLLSLLLTGCGGSDGKDGEDGKPGVVGVNINSTSTLKAKFTNATVDAGKVTVNFTLENANGVAVLGLTKDHDLRFGIAQLTPVKEKVGETEADRGYQWQAYINAKKEPGTVPSGVDNLNPSTQFQANVESANKCDTCLVDHGDGSYSYTYQVNVANVTEPVKVTYSADATQRATMELELPQLAANAHFDWQPSTGKTEGIQTRNVVSIQACYTCHQPESLALHGGRRIDIENCASCHTATSGDPESGNSIEFTYMIHAIHKGGERHTFDATGAQVPAPYKIIGYGGKVIDYGKVHYPQKPAADCAACHVEGAGAPANADLFKADLSNQACIGCHTEKPSAHHSSTDCMACHNATKPYGGTGSAAKRHGDVMKAYNDSLGYKAKFSNIGIKNNALTFDVQILDNKDQPIGKEFISDPSAYTKSSIYFSWGIDKDYPAYTAGSRYSDRGFALSNSKVSTYNEATKTFTIDSTNSNLKLPADLTGMNVELYAGVATCFNKGGYGVEDVVATPCSTDTRYAYIQDQPFRFKWNGTDTNSAAEKRRAIIDTAKCSGCHNKEIVHYDNGVNCQACHTPDKGLKTDNTYPGTKVPTSFAWKAHESEGHYLKYAGVQSGTVLKTDCATCHTADKSNVVTGIALGRSPERAWLYGDIKNNGAVIWVSSDAGACLSCHQKYLSDAAKSHIETNGGILNGTSAADVQTRASESCATCHTPSQLMEAHGN omca 1533529 n/a OmcA 1533530 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false t1 f1 f2 sf3 sf4 sf5 The crystal structure of OmcA reveals four molecules in the asymmetric unit giving a solvent content of 73% (Fig. S3). Superposition of the four OmcA molecules revealed that the overall RMSD between the main-chain atoms of each monomer were less than 0.5 Å, indicating no significant structural differences between the monomers of the asymmetric unit. Analysis of the arrangement of the four OmcA molecules in the asymmetric unit reveals two different orientations where the four monomers can be arranged in two structurally conserved OmcA dimers (Fig. S4).