MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014e-1 Crystal structure of FtsA from Staphylococcus aureus in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined matsumura@chem.eng.osaka-u.ac.jp 2014 imex curation Fujita J., Maeda Y., Nagao C., Tsuchiya Y., Miyazaki Y., Hirose M., Mizohata E., Matsumoto Y., Inoue T., Mizuguchi K., Matsumura H. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014j-2 Crystal structure of FtsA from Staphylococcus aureus in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by staining molecular weight estimation by staining weight by staining matsumura@chem.eng.osaka-u.ac.jp 2014 imex curation Fujita J., Maeda Y., Nagao C., Tsuchiya Y., Miyazaki Y., Hirose M., Mizohata E., Matsumoto Y., Inoue T., Mizuguchi K., Matsumura H. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014j-3 Crystal structure of FtsA from Staphylococcus aureus in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined matsumura@chem.eng.osaka-u.ac.jp 2014 imex curation Fujita J., Maeda Y., Nagao C., Tsuchiya Y., Miyazaki Y., Hirose M., Mizohata E., Matsumoto Y., Inoue T., Mizuguchi K., Matsumura H. FEBS Lett. (0014-5793) Only protein-protein interactions ftsa_staar Cell division protein FtsA ftsA SAR1161 protein protein strain mrsa252 Staphylococcus aureus MEEHYYVSIDIGSSSVKTIVGEKFHNGINVIGTGQTYTSGIKNGLIDDFDIARQAIKDTIKKASIASGVDIKEVFLKLPIIGTEVYDESNEIDFYEDTEINGSHIEKVLEGIREKNDVQETEVINVFPIRFIVDKENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVLDVYSDAYNYGSILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGRDITDDIAQGLNTSYETAEKVKHQYGHAFYDSASDQDIFTVEQVDSDETVQYTQKDLSDFIEARVEEIFFEVFDVLQDLGLTKVNGGFIVTGGSANLLGVKELLSDMVSEKVRIHTPSQMGIRKPEFSSAISTISSSIAFDELLDYVTINYHDNEETEEDVIDVKDKDNESKLGGFDWFKRKTNKKDTHENEVESSDEEIYQSEDNHQEHKQNHEHVQDKDKEESKFKKLMKSLFE ftsz_staar Cell division protein FtsZ ftsZ SAR1162 protein protein strain mrsa252 Staphylococcus aureus MLEFEQGFNHLATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFDDKPTSHGRKSGSTGFGTSVNTSSNATSKDESFTSNSSNAQATDSVSERTHTTKEDDIPSFIRNREERRSRRTRR ftsa-1 1533516 n/a SaFtsA 1533519 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false t1 f1 f2 sf1 sf2 The crystallographic asymmetric unit contains four SaFtsA molecules (chains A, B, C, and D). The A-B and C-D molecules stack head to tail in the crystal, thereby forming two antiparallel filamentous structures (Fig. 2 and Supplementary Fig. S1). ftsa-ftsz-10 1533517 n/a SaFtsZ 1533520 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified n/a SaFtsA 1533519 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false sf6 ftsa-ftsz-11 1533518 n/a SaFtsA 1533519 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n/a SaFtsZ 1533520 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false sf5