UniProt UniProt http://www.uniprot.org nandi-2014-2 MAVS protein is attenuated by rotavirus nonstructural protein 1. human-ht_29 Homo sapiens HT-29 caucasian women with colon adenocarcinoma ht_29 HT-29 confirmed as human with IEF of AST, LDH established from the primary tumor of a 44-year-old Caucasian woman with colon adenocarcinoma in 1964; described to be heterotransplantable forming well-differentiated grade I tumors anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nandi S., Chanda S., Bagchi P., Nayak M.K., Bhowmick R., Chawla-Sarkar M. HT19 cells have been infected with rotavirus SA11. Viral proteins have been mapped to UniProt rotavirus A SA11 reference proteome strain. However, Uniprot NSP1 seq has lenth of 496 aa(495 in publication). Tagged construct according pmid 23576507 (ref 29). chawlam70@gmail.com PLoS ONE 2014 imex curation Only protein-protein interactions imex curation nandi-2014-3 MAVS protein is attenuated by rotavirus nonstructural protein 1. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nandi S., Chanda S., Bagchi P., Nayak M.K., Bhowmick R., Chawla-Sarkar M. Viral proteins have been mapped to UniProt rotavirus A SA11 reference proteome strain. However, Uniprot NSP1 seq has lenth of 496 aa(495 in publication). Tagged construct according pmid 23576507 (ref 29). chawlam70@gmail.com PLoS ONE 2014 imex curation Only protein-protein interactions imex curation nandi-2014-1 MAVS protein is attenuated by rotavirus nonstructural protein 1. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Nandi S., Chanda S., Bagchi P., Nayak M.K., Bhowmick R., Chawla-Sarkar M. Viral proteins have been mapped to UniProt rotavirus A SA11 reference proteome strain. However, Uniprot NSP1 seq has lenth of 496 aa(495 in publication). Tagged construct according pmid 23576507 (ref 29). chawlam70@gmail.com PLoS ONE 2014 imex curation Only protein-protein interactions imex curation mavs_human Mitochondrial antiviral-signaling protein Interferon beta promoter stimulator protein 1 Virus-induced-signaling adapter CARD adapter inducing interferon beta Putative NF-kappa-B-activating protein 031N MAVS IPS1 KIAA1271 VISA protein protein human Homo sapiens Human MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH nsp1_rotsh Non-structural protein 1 NCVP2 Non-structural RNA-binding protein 53 protein protein rotsh Rotavirus A (isolate Monkey/South Africa/SA11-H96/1958 G3-P5B[2]-I2-R2-C5-M5-A5-N5-T5-E2-H5) MATFKDACFHYRRLTALNRRLCNIGANSICMPVPDAKIKGWCLECCQIADLTHCYGCSLPHVCKWCVQNRRCFLDNEPHLLKLRTVKHPITKDKLQCIIDLYNIIFPINDKVIRKFERMIKQRKCRNQYKIEWYNHLLLPITLNAAAFKFDENNLYYVFGLYEKSVSDIYAPYRIVNFINEFDKLLLDDINFTRMSNLPIELRNHYAKKYFQLSRLPSSKLKQIYFSDFTKETVIFNTYTKTPGRSIYRNVTEFNWRDELELYSDLKNDKNKLIAAMMTSKYTRFYAHDNNFGRLKMTIFELGHHCQPNYVASNHPGNASDIQYCKWCNIKYFLSKIDWRIRDMYNLLMEFIKDCYKSNVNVGHCSSVENIYPLIKRLIWSLFTNHMDQTIEEVFNHMSPVSVEGTNVIMLILGLNISLYNEIKRTLNVDSIPMVLNLNEFSSIVKSISSKWYNVDELDKLPMSIKSTEELIEMKNSGTLTEEFELLISNSEDDNE tbk1_human Serine/threonine-protein kinase TBK1 TBK1 NAK TANK-binding kinase 1 T2K NF-kappa-B-activating kinase protein protein human Homo sapiens Human MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL nsp1-mavs-2 1538048 n/a 1538051 unspecified role unspecified role prey prey n/a 1538052 unspecified role unspecified role bait bait physical association physical association false false false 6A mavs-nsp1-1 1538048 n/a 1538051 unspecified role unspecified role bait bait n/a 1538052 unspecified role unspecified role prey prey physical association physical association false false false 6A mavs-nsp1-2 1538049 n/a 1538051 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1538052 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus lvprgs his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false physical association physical association false false false 6B and 7B nsp1-mavs-1 1538049 n/a 1538051 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false certain certain sequence position certain range range false n/a 1538052 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus lvprgs his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 6B and 7D tbk1-mavs-1 1538050 n/a 1538051 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1538053 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 5D Coexpression of rotavirus A non-structural protein 1(His-tagged NSP1) diminishes interaction.