MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014m-1 Mannan binding lectin attenuates the Double-stranded RNA-mediated TLR3 activation and innate immunity human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line Human acute monocytic leukemia established from the peripheral blood of a 1-year-old boy with acute monocytic leukemia (AML) at relapse in 1978. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot zdaming@smu.edu.cn 2014 imex curation Liu H., Zhou J., Ma D., Lu X., Ming S., Shan G., Zhang X., Hou J., Chen Z., Zuo D. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014m-2 Mannan binding lectin attenuates the Double-stranded RNA-mediated TLR3 activation and innate immunity human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line Human acute monocytic leukemia established from the peripheral blood of a 1-year-old boy with acute monocytic leukemia (AML) at relapse in 1978. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining zdaming@smu.edu.cn 2014 imex curation Liu H., Zhou J., Ma D., Lu X., Ming S., Shan G., Zhang X., Hou J., Chen Z., Zuo D. FEBS Lett. (0014-5793) Only protein-protein interactions mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI tlr3_human Toll-like receptor 3 TLR3 protein protein human Homo sapiens Human MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIVLLIHFEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH tlr3-mbl2 1478592 n/a MBL 1478594 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell n/a TLR3 1478595 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4a We also examined the possibility of TLR3 interaction with exogenous MBL after entry into the cell. Indeed, the internalized MBL was physically associated with TLR3, as indicated by immunoprecipitation assays (Fig. 4A). mbl2-tlr3 1478593 n/a MBL 1478594 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component fixed cell fixed cell protein delivery protein delivery biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a TLR3 1478595 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f4b In addition, confocal microscopy showed that MBL could partially colocalize with TLR3 after entering into either monocytes or DCs (Fig. 4B).