MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014n-2 A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermooxidative stress, parasite growth and development plaf7 Plasmodium falciparum (isolate 3D7) fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining pawanm@icgeb.res.in 2014 imex curation Sharma S., Jadli M., Singh A., Arora K., Malhotra P. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014n-1 A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermooxidative stress, parasite growth and development in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot pawanm@icgeb.res.in 2014 imex curation Sharma S., Jadli M., Singh A., Arora K., Malhotra P. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014n-3 A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermooxidative stress, parasite growth and development plaf7 Plasmodium falciparum (isolate 3D7) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot pawanm@icgeb.res.in 2014 imex curation Sharma S., Jadli M., Singh A., Arora K., Malhotra P. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014n-4 A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermooxidative stress, parasite growth and development plaf7 Plasmodium falciparum (isolate 3D7) anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence pawanm@icgeb.res.in 2014 imex curation Sharma S., Jadli M., Singh A., Arora K., Malhotra P. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014n-5 A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermooxidative stress, parasite growth and development plaf7 Plasmodium falciparum (isolate 3D7) spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence pawanm@icgeb.res.in 2014 imex curation Sharma S., Jadli M., Singh A., Arora K., Malhotra P. FEBS J. (1742-464X) Only protein-protein interactions q8iar5_plaf7 PF3D7_0807700 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MDIIFCTPTYCKIMLMIIMLISLRTRCDTNNFLNCSVEKEEGEEEIISTNLKRINDDMNILGRILNDERNIKITDIVEMLQNEYDDKKKKKKKKKYIYRKKKSNNKINEINSVQHFNVKENILNEKKKNPLNDNFKNPKLRKHSPNNKKNKNKIGQIKFHIVGYDKKKITKYLTPSMISSIQKRLMNKNKKTNVNVNMSNGRVLPFFPKEYFLHSSTHEKKDKMATKKNNKEESIINERLLENLENISLSRTIKDIRGEEGNERKVKEEDNNIKEEGNSFKKYFKGVVKLYVDITEPNLEMIWQNYPPKSITGSGFIIEGHLIITNAHNISYSTRILIRKHGNSGKYEAKILYVAHDVDIAILTTDDKTFFDDVYALHFGALPSLKDEIITIGYPAGGDKLSVTEGIVSRIDVQYYKHSNYKFLLTQIDAPLNPGNSGGPALVRGKVVGICFQSYKVSNNISYIIPSTIISHFLLDIHKNKDYTGYAFLGVKYEPLENPSLREALGLEEMERKKIIKKNVGILITEVFEGHMSKQDDKYHDMDNKHHNVGDTHHNVGDTHHNVGDDHTDNLQGDTDYCTYILNSNIITSDKKNIYSDKKKKKIYSDNNNNNNNFNYYYNMHGEDEQSCYGLKKNDIILRVDGKDINNDGSVILRDNETVGFQHLFNEKFINDLCIIKIVRNKKIKSVMVKLYKVKYLLNQHNWDKRNKYFIYGGIVFSILTRSLYVYTQNPEINKLMLYNNFKKKSKDEIVVLKNILPTKITTGYYYTDSIVLRVNNIKVKNLKHLIELIEMTKYTNRLMYLKNNKHTLQSYINYYNTKITSLNINTIIHILILTTSGQKVPIVLNKRDVEKYNEEIKKIYSITRDRYVY q8ib24_plaf7 PF3D7_0818900 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MASAKGSKPNLPESNIAIGIDLGTTYSCVGVWRNENVDIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVARNPENTVFDAKRLIGRKFTESSVQSDMKHWPFTVKSGVDEKPMIEVTYQGEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFNDSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLHKKGKGEKNILIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVNFCVEDFKRKNRGKDLSKNSRALRRLRTQCERAKRTLSSSTQATIEIDSLFEGIDYSVTVSRARFEELCIDYFRDTLIPVEKVLKDAMMDKKSVHEVVLVGGSTRIPKIQTLIKEFFNGKEACRSINPDEAVAYGAAVQAAILSGDQSNAVQDLLLLDVCSLSLGLETAGGVMTKLIERNTTIPAKKSQIFTTYADNQPGVLIQVYEGERALTKDNNLLGKFHLDGIPPAPRKVPQIEVTFDIDANGILNVTAVEKSTGKQNHITITNDKGRLSQDEIDRMVNDAEKYKAEDEENRKRIEARNSLENYCYGVKSSLEDQKIKEKLQPAEIETCMKTITTILEWLEKNQLAGKDEYEAKQKEAESVCAPIMSKIYQDAAGAAGGMPGGMPGGMPGGMPGGMNFPGGMPGAGMPGNAPAGSGPTVEEVD eno_plaf7 Enolase 2-phosphoglycerate dehydratase 2-phospho-D-glycerate hydro-lyase ENO PF10_0155 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MAHVITRINAREILDSRGNPTVEVDLETNLGIFRAAVPSGASTGIYEALELRDNDKSRYLGKGVQKAIKNINEIIAPKLIGMNCTEQKKIDNLMVEELDGSKNEWGWSKSKLGANAILAISMAVCRAGAAANKVSLYKYLAQLAGKKSDQMVLPVPCLNVINGGSHAGNKLSFQEFMIVPVGAPSFKEALRYGAEVYHTLKSEIKKKYGIDATNVGDEGGFAPNILNANEALDLLVTAIKSAGYEGKVKIAMDVAASEFYNSENKTYDLDFKTPNNDKSLVKTGAQLVDLYIDLVKKYPIVSIEDPFDQDDWENYAKLTAAIGKDVQIVGDDLLVTNPTRITKALEKNACNALLLKVNQIGSITEAIEACLLSQKNNWGVMVSHRSGETEDVFIADLVVALRTGQIKTGAPCRSERNAKYNQLLRIEESLGNNAVFAGEKFRLQLN q8ila4_plaf7 Glucose-6-phosphate isomerase PF3D7_1436000 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MNMEITNLKSYKELVTLSAEEKTKDLKDYLNDKNRSESLIKKFKNFYMDLSRQRYSEKTLNKLVEYAEEVELKKKVEKTFMGEKVNMTENRSVLHTALRIPIEKINTHKIIIDNKNVLEDVHGVLKKIEKYSDDIRNGVIKTCKNTKFKNVICIGIGGSYLGTEFVYEAMKYYYYNMELNKNEKDQVNNFNNNYDQDNVFNVRFLANVDPNDVNRAIQNLDQYDTLVIIISKTFTTAETMLNARSIKKWLSLKIKDDENLSKHMVAVSTNLKLTDEFGISRDNVFEFWDWVGGRFSVTSSVGILPLSIAFGYKNMRNFLNGCHDMDEHFLHADLKENIPVLLALTSFYNSHFFDYKNVAILPYFQNLLKFSAHIQQLSMESNGKSVDRNNQPIHYNTCQVYFGEPGTNGQHSFYQLIHQGQVIPVELIGFKHSHFPIKFDKEVVSNHDELMTNFFAQADALAIGKTYEQVKEENEKNKMSPELLTHKVFNGNRPSTLLLFDELNFYTCGLLLSLYESRIVAEGFLLNINSFDQWGVELGKVLAKEVRNYFNDTRNQKKSDNTYNFNESTKILLNYYLSK q76nm3_plaf7 L-lactate dehydrogenase PF3D7_1324900 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA oat_plaf7 Ornithine aminotransferase OAT Ornithine--oxo-acid aminotransferase PFF0435w protein protein plaf7 Plasmodium falciparum (isolate 3D7) MDFVKELKSSQDYMNNELTYGAHNYDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKKLTICSRAFFSDSLGVCERYLTNLFGYDKVLMMNTGAEASETAYKLCRKWGYEVKKIPENSAKIIVCNNNFSGRTLGCVSASTDKKCKNNFGPFVPNFLKVPYDDLEALEKELQDPNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGGHYPISAILANDDVMLVLKPGEHGSTYGGNPLAAAICVEALKVLINEKLCENADKLGAPFLQNLKEQLKDSKVVREVRGKGLLCAIEFKNDLVNVWDICLKFKENGLITRSVHDKTVRLTPPLCITKEQLDECTEIIVKTVKFFDDNL sodf_plaf7 Superoxide dismutase [Fe] SODB FeSOD PF08_0071 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MVITLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSGAIFNNAAQIWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALNNNNKLVILQTHDAGNPIKDNTGIPILTCDIWEHAYYIDYRNDRASYVKAWWNLVNWNFANENLKKAMQK q8iar5-q8ib24-1 1479098 n/a PfDegP 1479103 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell n/a PfHsp-70 1479104 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f5b q8iar5-q8ib24-2 1479098 n/a PfDegP 1479103 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell n/a PfEno 1479105 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f5c q8iar5-q8ib24 1479099 n/a PfHsp-70 1479104 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfDegP 1479103 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false f5a q8iar5-q8ib24-3 1479100 n/a PfEno 1479105 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfDegP 1479103 predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfHsp-70 1479104 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f5d eno-oat 1479101 n/a PfDegP 1479103 predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfGpi 1479106 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfLDH 1479107 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfHsp-70 1479104 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfOat 1479108 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfSod 1479109 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfEno 1479105 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false sf3b t2 q8iar5-eno 1479102 n/a PfDegP 1479103 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified n/a PfLDH 1479107 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfGpi 1479106 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfSod 1479109 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfEno 1479105 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfHsp-70 1479104 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PfOat 1479108 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false sf3b t2