MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint schwenk-2014-1 The FTLD risk factor TMEM106B and MAP6 control dendritic trafficking of lysosomes. rat-brain-hippocampus Hippocampus of rat brain rat-brain-hippocampus Hippocampus of rat brain fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Schwenk B.M., Lang C.M., Hogl S., Tahirovic S., Orozco D., Rentzsch K., Lichtenthaler S.F., Hoogenraad C.C., Capell A., Haass C., Edbauer D. dieter.edbauer@dzne.de EMBO J. (0261-4189) 2014 imex curation Only protein-protein interactions schwenk-2014-2 The FTLD risk factor TMEM106B and MAP6 control dendritic trafficking of lysosomes. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schwenk B.M., Lang C.M., Hogl S., Tahirovic S., Orozco D., Rentzsch K., Lichtenthaler S.F., Hoogenraad C.C., Capell A., Haass C., Edbauer D. dieter.edbauer@dzne.de EMBO J. (0261-4189) 2014 imex curation Only protein-protein interactions schwenk-2014-4 The FTLD risk factor TMEM106B and MAP6 control dendritic trafficking of lysosomes. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schwenk B.M., Lang C.M., Hogl S., Tahirovic S., Orozco D., Rentzsch K., Lichtenthaler S.F., Hoogenraad C.C., Capell A., Haass C., Edbauer D. dieter.edbauer@dzne.de EMBO J. (0261-4189) 2014 imex curation Only protein-protein interactions schwenk-2014-3 The FTLD risk factor TMEM106B and MAP6 control dendritic trafficking of lysosomes. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Schwenk B.M., Lang C.M., Hogl S., Tahirovic S., Orozco D., Rentzsch K., Lichtenthaler S.F., Hoogenraad C.C., Capell A., Haass C., Edbauer D. dieter.edbauer@dzne.de EMBO J. (0261-4189) 2014 imex curation Only protein-protein interactions schwenk-2014-5 The FTLD risk factor TMEM106B and MAP6 control dendritic trafficking of lysosomes. rat-brain Rattus norvegicus brain brain Brain [cerebrum] density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Schwenk B.M., Lang C.M., Hogl S., Tahirovic S., Orozco D., Rentzsch K., Lichtenthaler S.F., Hoogenraad C.C., Capell A., Haass C., Edbauer D. dieter.edbauer@dzne.de EMBO J. (0261-4189) 2014 imex curation Only protein-protein interactions t106b_rat Transmembrane protein 106B Tmem106b protein protein rat Rattus norvegicus (Rat) Rat MGKSLSHLPLHSNKEDGYDGVTSTDNMRNGLVSSEVRNEDGRSGDVSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIDVKYIGVKSAYVSYDSQKRMIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLSNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLPSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTTYQLAQSEYLNVLQPQQ lamp1_rat Lysosome-associated membrane glycoprotein 1 120 kDa lysosomal membrane glycoprotein CD107 antigen-like family member A Lamp1 Lamp-1 protein protein rat Rattus norvegicus (Rat) Rat MAAPGARRPLLLLLLAGLAHSAPALFEVKDNNGTACIMASFSASFLTTYDAGHVSKVSNMTLPASAEVLKNSSSCGEKNASEPTLAITFGEGYLLKLTFTKNTTRYSVQHMYFTYNLSDTQFFPNASSKGPDTVDSTTDIKADINKTYRCVSDIRVYMKNVTIVLWDATIQAYLPSSNFSKEETRCPQDQPSPTTGPPSPSPPLVPTNPSVSKYNVTGDNGTCLLASMALQLNITYMKKDNTTVTRAFNINPSDKYSGTCGAQLVTLKVGNKSRVLELQFGMNATSSLFFLQGVQLNMTLPDAIEPTFSTSNYSLKALQASVGNSYKCNSEEHIFVSKALALNVFSVQVQAFRVESDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI map6_rat Microtubule-associated protein 6 Map6 Mtap6 Stable tubule-only polypeptide 145-kDa STOP protein protein rat Rattus norvegicus (Rat) Rat MAWPCITRACCIARFWNQLDKADIAVPLVFTKYSEATEHPGAPPQPPAPPQPGLAPPSRAVAIETQPAQGESDAVARATGPAPGPSGDRETAAAPGRSGLGLGAASGSTSGSGPADSVMRQDYRAWKVQRPEPSCRPRSEYQPSDAPFERETQYQKDFRAWPLPRRGDHPWIPKPVQIPATSQPSPPVLGMPKRRPQSQERGPIQLSADARDPEGAGGAGVPAAGKASGADQRDTRRKAGPAWMVTRTEGHEEKPLPPAQSQTQEGGPAAGKASGADQRDTRRKAGPAWMVTRTEGHEEKPLPPAQSQTQEGGPAAGKASGADQRDTRRKAGPAWMVTRTEGHEETPLPPAQSQTQEGGPAAGKASGADQRDTRRKAGPAWMVTRTEGHEETPLPPAQSQTQEGGPAAGKASGADERDTRRKAGPAWMVRRSEGHEQTTAAHAQGTGPEGGKGRAVADALNRQIREEVTSTVSSSYRNEFRAWTDIKPVKPIKAKPQYKPPDDKMVHETSYSAQFKGEASKPTTADNKVVDRRRIRSLYSEPFKESPKVEKPSVQSSKPKKTSTSQKPLRKAKDKQVASGQAAKKKTTESPSATKPDDKEQSKEMNNKLAEAKESRVKPTSDKNQGPVAKEPHKDQGPVAPGLPKGQGPAVQEPLKDQGPMVPGLPKDQAPVVPGSLKGQSPTAPGPPKDQGAVLLGPMKDLGPVAPASVKDQDHMASELLKNKDSVPLAPAKAQSPLLPEPLKNQSPVVPARAKDQSFPAPAPTPLKDPGPVIPEPEKDGAPMVPERRKDQNASIMASLKNEAPVASESVKNQGLGGPEPAKDTGTDLKGHGSVFVAPVKSQGPVVPEPTKGQDPIIPALAKDQGPILPEPPKNQGPPVVLGPIKNQDPVIPVPLKGQDPVVPAPTKDPGPTAPDPLKSQGPRGPQLPTVSPSPPVMIPTVPHAEYIEGSP q96je9-1 Microtubule-associated protein 6 N-STOP Neuronal-STOP MAP6 KIAA1878 Stable tubule-only polypeptide protein protein human Homo sapiens Human MAWPCITRACCIARFWNQLDKADIAVPLVFTKYSEATEHPGAPPQPPPPQQQAQPALAPPSARAVAIETQPAQGELDAVARATGPAPGPTGEREPAAGPGRSGPGPGLGSGSTSGPADSVMRQDYRAWKVQRPEPSCRPRSEYQPSDAPFERETQYQKDFRAWPLPRRGDHPWIPKPVQISAASQASAPILGAPKRRPQSQERWPVQAAAEAREQEAAPGGAGGLAAGKASGADERDTRRKAGPAWIVRRAEGLGHEQTPLPAAQAQVQATGPEAGRGRAAADALNRQIREEVASAVSSSYRNEFRAWTDIKPVKPIKAKPQYKPPDDKMVHETSYSAQFKGEASKPTTADNKVIDRRRIRSLYSEPFKEPPKVEKPSVQSSKPKKTSASHKPTRKAKDKQAVSGQAAKKKSAEGPSTTKPDDKEQSKEMNNKLAEAKESLAQPVSDSSKTQGPVATEPDKDQGSVVPGLLKGQGPMVQEPLKKQGSVVPGPPKDLGPMIPLPVKDQDHTVPEPLKNESPVISAPVKDQGPSVPVPPKNQSPMVPAKVKDQGSVVPESLKDQGPRIPEPVKNQAPMVPAPVKDEGPMVSASVKDQGPMVSAPVKDQGPIVPAPVKGEGPIVPAPVKDEGPMVSAPIKDQDPMVPEHPKDESAMATAPIKNQGSMVSEPVKNQGLVVSGPVKDQDVVVPEHAKVHDSAVVAPVKNQGPVVPESVKNQDPILPVLVKDQGPTVLQPPKNQGRIVPEPLKNQVPIVPVPLKDQDPLVPVPAKDQGPAVPEPLKTQGPRDPQLPTVSPLPRVMIPTAPHTEYIESSP rab7a_rat Ras-related protein Rab-7a Rab7a Ras-related protein p23 Ras-related protein BRL-RAS Rab7 protein protein rat Rattus norvegicus (Rat) Rat MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNERAKASAESCSC lamp1-tmem106b 1531037 n/a 1531042 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell n/a 1531043 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f2a sf2a sf5a sf6b lamp1-tmem106b-1 1531037 n/a 1531042 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell n/a 1531044 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false sf6b double immunofluorescence shows predominant microtubule-like staining of MAP6 in dendrites and axons and vesicular staining in the soma with some overlap with TMEM106B-positive vesicles (Supplementary Fig S6B). tmem106b-map6 1531038 n/a 1531044 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1531042 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4a map6-tmem106b 1531038 n/a 1531044 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1531042 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4b map6-tmem106b-2 1531039 n/a 1531042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1531044 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4c map6-tmem106b-3 1531039 n/a 1531042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1531045 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4c tmem106b-map6-1 1531040 n/a 1531044 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1531042 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false sf6a map6-rab7a 1531041 n/a 1531046 western blot western blot Immuno blot Immuno blot unspecified role unspecified role unspecified role unspecified role subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1531042 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1531044 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false f4d To further support the biological relevance of the interaction between TMEM106B and MAP6, we performed subcellular fractionation of rat brain on a discontinuous iodixanol density gradient. While ßIII-tubulin was broadly distributed over the whole gradient, TMEM106B and MAP6 levels peaked in endosomal/lysosomal fractions (marker protein Rab7) supporting close contact of the two proteins in the same cellular compartment (Fig 4D).