IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ de-2013a-1 The human minor histocompatibility antigen 1 is a RhoGAP. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry de Kreuk B.J., Schaefer A., Anthony E.C., Tol S., Fernandez-Borja M., Geerts D., Pool J., Hambach L., Goulmy E., Hordijk P.L. IBD - Inflammatory bowel disease Supplementary Figures S2 and S3 seem to have been mislabeled: Fig. S2 shows GST pulldown assays described in the text as Fig. S3, while Fig. S3 shows immunostaining images described in the text as Fig. S2. Although not explicitely mentioned in the materials and methods section, the origin of HMHA1 was derived from the title and the protein architecture drawing in Fig. 1A (only the human HMHA1 protein has 1136 amino acid residues). p.hordijk@sanquin.nl PLoS ONE 2013 Only protein-protein interactions imex curation Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Fig. 8c and 8d show the results of an in vitro GTPase assay, indicating that HMHA1 has in vitro GAP activity towards Rac1, Cdc42 and RhoA but not Ras; however it was not possible to establish the origin of the proteins used in these experiments and authors did not reply to a request for clarification, hence these interactions are not captured here. de-2013a-2 The human minor histocompatibility antigen 1 is a RhoGAP. human-jurkat Homo sapiens jurkat Human T cell leukemia facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection de Kreuk B.J., Schaefer A., Anthony E.C., Tol S., Fernandez-Borja M., Geerts D., Pool J., Hambach L., Goulmy E., Hordijk P.L. IBD - Inflammatory bowel disease Supplementary Figures S2 and S3 seem to have been mislabeled: Fig. S2 shows GST pulldown assays described in the text as Fig. S3, while Fig. S3 shows immunostaining images described in the text as Fig. S2. p.hordijk@sanquin.nl PLoS ONE 2013 Only protein-protein interactions imex curation Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Fig. 8c and 8d show the results of an in vitro GTPase assay, indicating that HMHA1 has in vitro GAP activity towards Rac1, Cdc42 and RhoA but not Ras; however it was not possible to establish the origin of the proteins used in these experiments and authors did not reply to a request for clarification, hence these interactions are not captured here. de-2013a-3 The human minor histocompatibility antigen 1 is a RhoGAP. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot de Kreuk B.J., Schaefer A., Anthony E.C., Tol S., Fernandez-Borja M., Geerts D., Pool J., Hambach L., Goulmy E., Hordijk P.L. IBD - Inflammatory bowel disease Supplementary Figures S2 and S3 seem to have been mislabeled: Fig. S2 shows GST pulldown assays described in the text as Fig. S3, while Fig. S3 shows immunostaining images described in the text as Fig. S2. This experiment is described in more detail in PMID:21693584 and PMID:16492808. The GST-tagged Rac1 construct is described in PMID:21693584 and PMID:14675773. p.hordijk@sanquin.nl PLoS ONE 2013 Only protein-protein interactions imex curation Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Fig. 8c and 8d show the results of an in vitro GTPase assay, indicating that HMHA1 has in vitro GAP activity towards Rac1, Cdc42 and RhoA but not Ras; however it was not possible to establish the origin of the proteins used in these experiments and authors did not reply to a request for clarification, hence these interactions are not captured here. rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL hmha1_human Rho GTPase-activating protein 45 ARHGAP45 HMHA1 KIAA0223 protein protein human Homo sapiens Human MFSRKKRELMKTPSISKKNRAGSPSPQPSGELPRKDGADAVFPGPSLEPPAGSSGVKATGTLKRPTSLSRHASAAGFPLSGAASWTLGRSHRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLRDDLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAAGTLIAKVKAFHYESNNDLEKQEFEKALETIAVAFSSTVSEFLMGEVDSSTLLAVPPGDSSQSMESLYGPGSEGTPPSLEDCDAGCLPAEEVDVLLQRCEGGVDAALLYAKNMAKYMKDLISYLEKRTTLEMEFAKGLQKIAHNCRQSVMQEPHMPLLSIYSLALEQDLEFGHSMVQAVGTLQTQTFMQPLTLRRLEHEKRRKEIKEAWHRAQRKLQEAESNLRKAKQGYVQRCEDHDKARFLVAKAEEEQAGSAPGAGSTATKTLDKRRRLEEEAKNKAEEAMATYRTCVADAKTQKQELEDTKVTALRQIQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEPHVSANAWSPVMRARKSSFNVSDVARPEAAGSPPEEGGCTEGTPAKDHRAGRGHQVHKSWPLSISDSDSGLDPGPGAGDFKKFERTSSSGTMSSTEELVDPDGGAGASAFEQADLNGMTPELPVAVPSGPFRHEGLSKAARTHRLRKLRTPAKCRECNSYVYFQGAECEECCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFSHAARSAPDGVPFIVKKCVCEIERRALRTKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQLPEPLISFRLYHELVGLAKDSLKAEAEAKAASRGRQDGSESEAVAVALAGRLRELLRDLPPENRASLQYLLRHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRPTEATVSLSSLVDYPHQARVIETLIVHYGLVFEEEPEETPGGQDESSNQRAEVVVQVPYLEAGEAVVYPLQEAAADGCRESRVVSNDSDSDLEEASELLSSSEASALGHLSFLEQQQSEASLEVASGSHSGSEEQLEATAREDGDGDEDGPAQQLSGFNTNQSNNVLQAPLPPMRLRGGRMTLGSCRERQPEFV cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL rhoa_human Transforming protein RhoA Rho cDNA clone 12 ARHA RHO12 RHOA ARH12 protein protein human Homo sapiens Human MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL hmha1-rac1 1573572 n/a 1573575 unspecified role unspecified role neutral component neutral component n/a 1573576 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 5a cdc42-hmha1 1573572 n/a 1573577 unspecified role unspecified role neutral component neutral component n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P60953:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain false constitutively active Cdc42 mutant n/a 1573576 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 5c hmha1-rhoa 1573572 n/a 1573576 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1573578 unspecified role unspecified role neutral component neutral component n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P61586:p.Gly14Val mutation mutation certain certain sequence position certain certain certain sequence position certain false constitutively active RhoA mutant colocalization colocalization false false false Fig. 5d hmha1-rac1-2 1573573 n/a 1573575 unspecified role unspecified role neutral component neutral component n/a 1573576 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 6, Suppl. Fig. S2 (3) CXCL12 (100 ng/ml), a chemokine rac1-hmha1 1573574 n/a 1573576 unspecified role unspecified role prey prey rhogap_dom sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) n/a 1573575 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain undetermined undetermined sequence position undetermined false GST-Rac1 construct that lacks the "C-terminal hypervariable domain" ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Suppl. Fig. 3 (2) More HMHA1 is pulled down by Rac1 loaded with GppNHp, a non-hydrolyzable GTP analog, compared to GDP-loaded Rac1, indicating that HMHA1 preferably binds the active conformation of Rac1. Q92619 decreases activity of P63000