UniProt UniProt http://www.uniprot.org vaibhava-2012-4 Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in J. Cell. Sci. (0021-9533) 2012 imex curation Only protein-protein interactions vaibhava-2012-1 Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in J. Cell. Sci. (0021-9533) 2012 imex curation Only protein-protein interactions vaibhava-2012-3 Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in J. Cell. Sci. (0021-9533) 2012 imex curation Only protein-protein interactions vaibhava-2012-2 Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in J. Cell. Sci. (0021-9533) 2012 imex curation Only protein-protein interactions vaibhava-2012-5 Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in J. Cell. Sci. (0021-9533) 2012 imex curation Only protein-protein interactions vaibhava-2012-6 Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in J. Cell. Sci. (0021-9533) 2012 imex curation Only protein-protein interactions tbc17_human TBC1 domain family member 17 TBC1D17 protein protein human Homo sapiens Human MEGAGYRVVFEKGGVYLHTSAKKYQDRDSLIAGVIRVVEKDNDVLLHWAPVEEAGDSTQILFSKKDSSGGDSCASEEEPTFDPDYEPDWAVISTVRPQLCHSEPTRGAEPSCPQGSWAFSVSLGELKSIRRSKPGLSWAYLVLVTQAGGSLPALHFHRGGTRALLRVLSRYLLLASSPQDSRLYLVFPHDSSALSNSFHHLQLFDQDSSNVVSRFLQDPYSTTFSSFSRVTNFFRGALQPQPEGAASDLPPPPDDEPEPGFEVISCVELGPRPTVERGPPVTEEEWARHVGPEGRLQQVPELKNRIFSGGLSPSLRREAWKFLLGYLSWEGTAEEHKAHIRKKTDEYFRMKLQWKSVSPEQERRNSLLHGYRSLIERDVSRTDRTNKFYEGPENPGLGLLNDILLTYCMYHFDLGYVQGMSDLLSPILYVIQNEVDAFWCFCGFMELVQGNFEESQETMKRQLGRLLLLLRVLDPLLCDFLDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVLWTGLPGPNLHLLVACAILDMERDTLMLSGFGSNEILKHINELTMKLSVEDVLTRAEALHRQLTACPELPHNVQEILGLAPPAEPHSPSPTASPLPLSPTRAPPTPPPSTDTAPQPDSSLEILPEEEDEGADS optn_human Optineurin HYPL Optic neuropathy-inducing protein E3-14.7K-interacting protein FIP-2 Huntingtin-interacting protein L Huntingtin yeast partner L NEMO-related protein Transcription factor IIIA-interacting protein OPTN FIP2 GLC1E NRP HIP7 Huntingtin-interacting protein 7 protein protein human Homo sapiens Human MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNEKQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII tfr1_human Transferrin receptor protein 1 TFRC T9 p90 protein protein human Homo sapiens Human MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSGVGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL optn-tbc1d17-4 1554581 n/a 1554587 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1554588 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q96CV9:p.Glu50Lys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 1G, H, S5A tbc1d17-tfrc 1554581 n/a 1554587 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1554589 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false S1A Optineurin (HA-tagged optineurin transfected, UniProt AC Q96CV9) enhanced colocalization. rab8a-tbc1d17 1554581 n/a 1554590 unspecified role unspecified role neutral component neutral component n/a 1554587 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Knock down of optineurin decreases interaction. colocalization colocalization false false false 2B and S1C Optineurin (HA-tagged optineurin Uniprot AC Q96CV9 transfected) enhanced the innteraction. rab8a-tfrc 1554581 n/a 1554589 unspecified role unspecified role neutral component neutral component n/a 1554590 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 6D In cells coexpressing TBC1D17 and Rab8, the amount of Rab8 colocalising with TFRC was significantly reduced. Catalitically inactive TBC1D17 (GFP-tagged TBC1D17 Uniprot AC Q9HA65 transfected with a arg381ala mutation) had no effect on the interaction. rab8a-tfrc-1 1554581 n/a 1554589 unspecified role unspecified role neutral component neutral component n/a 1554590 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection P61006:p.Thr22Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false S3A TBC1D17 (GFP-tagged TBC1D17 Uniprot AC Q9HA65 transfected) with a arg381ala mutation enhanced the innteraction. optn-rab8a-2 1554581 n/a 1554588 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q96CV9:p.Glu50Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 1554590 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 8C optn-tbc1d17-1 1554582 n/a 1554587 unspecified role unspecified role prey prey n/a 1554588 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false OPTN glu50lys also interacted physical association physical association false false false 1A, S3C, S4B rab8a-optn 1554582 n/a 1554590 unspecified role unspecified role bait bait n/a 1554588 unspecified role unspecified role prey prey Q96CV9:p.Glu50Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false UniProt FTId: VAR_021538. dbSNP: rs28939688. Involved in GLC1E (OMIM 1377609. OPTN glu50lys also interacted physical association physical association false false false S6 optn-tbc1d17-3 1554583 n/a 1554588 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1554587 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false 1E and F tfrc-rab8a 1554583 n/a 1554589 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1554590 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false P61006:p.Thr22Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 6B and C Co-transfection of GFP-tagged TBC1D17 (UniProt AC Q9HA65) with arg381ala mutation enhanced interaction. optn-tbc1d17-2 1554584 n/a 1554587 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1554588 unspecified role unspecified role bait bait physical association physical association false false false 1C tbc1d17-optn 1554585 n/a 1554588 unspecified role unspecified role prey prey n/a 1554590 unspecified role unspecified role prey prey n/a 1554587 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 2A Knock down of optineurin abolishes the interaction. optn-tbc1d17-5 1554586 n/a 1554587 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1554588 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false OPTN glu50lys also interacted physical association physical association false false false 2A Knock down of optineurin abolishes the interaction.