IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ rauen-2011-2 cAMP-responsive element modulator (CREM)α protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus. human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Rauen T., Hedrich C.M., Juang Y.T., Tenbrock K., Tsokos G.C. IBD - Inflammatory bowel disease Interactions in human T cells and SLE T cells between the IL17A gene promoter and histone H3 that were determined by ChIP (Fig. 4) using anti-H3 antibody were not captured here due to lack of antibody specificity. Chromatin immunoprecipitation was performed with T cells from healthy individuals and T cells from SLE patients. The exact isoform of CREM detected in ChIP experiments cannot be identified; the antibody used (described in PMID:15841182) potentially reacts with ~15 isoforms of human CREM. trauen@bidmc.harvard.edu,gtsokos@bidmc.harvard.edu J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation The human DNMT3a expression construct is described in PMID:21346232. rauen-2011-1 cAMP-responsive element modulator (CREM)α protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus. human-t cells cd 4+ Homo sapiens t-cell_cd4+ t cell cd4+ ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Rauen T., Hedrich C.M., Juang Y.T., Tenbrock K., Tsokos G.C. IBD - Inflammatory bowel disease Interactions in human T cells and SLE T cells between the IL17A gene promoter and histone H3 that were determined by ChIP (Fig. 4) using anti-H3 antibody were not captured here due to lack of antibody specificity. Chromatin was immunoprecipitated from both naïve CD4+ T cells and CD4+ T cells activated by incubation in the presence of plate-bound anti-CD3 and anti-CD28 antibodies. The exact isoform of CREM detected in ChIP experiments cannot be identified; the antibody used (described in PMID:15841182) potentially reacts with ~15 isoforms of human CREM. trauen@bidmc.harvard.edu,gtsokos@bidmc.harvard.edu J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation The human DNMT3a expression construct is described in PMID:21346232. rauen-2011-6 cAMP-responsive element modulator (CREM)α protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Rauen T., Hedrich C.M., Juang Y.T., Tenbrock K., Tsokos G.C. IBD - Inflammatory bowel disease Interactions in human T cells and SLE T cells between the IL17A gene promoter and histone H3 that were determined by ChIP (Fig. 4) using anti-H3 antibody were not captured here due to lack of antibody specificity. The exact isoform of CREM detected in ChIP experiments cannot be identified; the antibody used (described in PMID:15841182) potentially reacts with ~15 isoforms of human CREM. trauen@bidmc.harvard.edu,gtsokos@bidmc.harvard.edu J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation The human DNMT3a expression construct is described in PMID:21346232. crem_human cAMP-responsive element modulator CREM Inducible cAMP early repressor protein protein human Homo sapiens Human MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQLPSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY il17_human_gene Interleukin-17A (IL17A) human gene IL17A CTLA8 IL17 gene gene human Homo sapiens Human hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA dnm3a_human DNA (cytosine-5)-methyltransferase 3A DNMT3A DNA methyltransferase HsaIIIA Cysteine methyltransferase DNMT3A protein protein human Homo sapiens Human MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEEASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV il17_human_cre-site_dna-probe Human IL17 gene promoter cAMP-responsive element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CACGTAAGTGACCACAGAAGG crem-il17-2 1767704 n/a 1767707 unspecified role unspecified role bait bait n/a 1767708 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2e, 2f Chromatin immunoprecipitation was performed with T cells from healthy individuals and T cells from SLE patients. A trend was observed towards increased binding in SLE T cells; however, the difference was not statistically significant. hdac1-il17-1 1767704 n/a 1767708 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767709 unspecified role unspecified role bait bait association association false false false Fig. 5c, 5d Chromatin immunoprecipitation was performed with T cells from healthy individuals and T cells from SLE patients. The interaction was significantly decreased in the latter. Although the figure legend is titled 'Increased HDAC1 recruitment to the CRE site in SLE T cells', both the figure and the main text clearly indicate less HDAC1 binding to this site in these cells. dnmt3a-il17-1 1767704 n/a 1767708 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767710 unspecified role unspecified role bait bait association association false false false Fig. 7a, 7b Chromatin immunoprecipitation was performed with T cells from healthy individuals and T cells from SLE patients. The interaction was significantly decreased in the latter. Q9Y6K1 decreases expression at RNA level of ENSG00000112115 crem-il17-1 1767705 n/a 1767708 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767707 unspecified role unspecified role bait bait association association false false false Fig. 2c, 2d The interaction was significantly increased in activated CD4+ T cells. Binding was increased in Th17 helper cells (which express IL17) as compared to Th1 and 2 cells (Fig. 3). anti-CD3 and anti-CD28 antibodies Q03060 increases expression at RNA level of ENSG00000112115 hdac1-il17-2 1767705 n/a 1767708 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767709 unspecified role unspecified role bait bait association association false false false Fig. 5a, 5b The interaction was significantly decreased in activated CD4+ T cells. Although the figure legend is titled 'Increased HDAC1 recruitment to the CRE site after T cell activation', both the figure and the main text clearly indicate less HDAC1 binding to this site in activated cells. anti-CD3 and anti-CD28 antibodies il17-crem-1 1767706 n/a 1767711 unspecified role unspecified role bait bait atp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1767707 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes physical association physical association false false false Fig. 2a