IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ shibata-2011a-1 How coenzyme B12-dependent ethanolamine ammonia-lyase deals with both enantiomers of 2-amino-1-propanol as substrates: structure-based rationalization. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shibata N., Higuchi Y., Toraya T. toraya@cc.okayama-u.ac.jp, shibach@sci.u-hyogo.ac.jp Biochemistry (0006-2960) 2011 Only protein-protein interactions imex curation (2r)-1-aminopropan-2-ol (2R)-1-aminopropan-2-ol (2R)-(-)-2-hydroxypropylamine (2R)-(-)-hydroxypropylamine (2R)-1-aminopropan-2-ol (R)-(-)-1-amino-2-propanol (R)-(-)-1-aminopropan-2-ol (R)-1-Amino-2-propanol (R)-1-amino-2-propanol (R)-1-Aminopropan-2-ol (R)-1-aminopropan-2-ol (2R)-1-aminopropan-2-ol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) HXKKHQJGJAFBHI-GSVOUGTGSA-N cobalamin cobalamin cobalamin COBALAMIN Coalpha-[alpha-(5,6-dimethylbenzimidazolyl)]-cobamide cobalamin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) OMAOKVYASDIYQG-DSRCUDDDSA-L eutb_ecoli Ethanolamine ammonia-lyase large subunit eutB Ethanolamine ammonia-lyase alpha subunit Ethanolamine ammonia-lyase heavy chain Ethanolamine deaminase large subunit JW2434 b2441 protein protein ecoli Escherichia coli (strain K12) MKLKTTLFGNVYQFKDVKEVLAKANELRSGDVLAGVAAASSQERVAAKQVLSEMTVADIRNNPVIAYEDDCVTRLIQDDVNETAYNQIKNWSISELREYVLSDETSVDDIAFTRKGLTSEVVAAVAKICSNADLIYGAKKMPVIKKANTTIGIPGTFSARLQPNDTRDDVQSIAAQIYEGLSFGVGDAVIGVNPVTDDVENLSRVLDTIYGVIDKFNIPTQGCVLAHVTTQIEAIRRGAPGGLIFQSICGSEKGLKEFGVELAMLDEARAVGAEFNRIAGENCLYFETGQGSALSAGANFGADQVTMEARNYGLARHYDPFIVNTVVGFIGPEYLYNDRQIIRAGLEDHFMGKLSGISMGCDCCYTNHADADQNLNENLMILLATAGCNYIMGMPLGDDIMLNYQTTAFHDTATVRQLLNLRPSPEFERWLESMGIMANGRLTKRAGDPSLFF eutc_ecoli Ethanolamine ammonia-lyase small subunit eutC Ethanolamine ammonia-lyase beta subunit Ethanolamine ammonia-lyase light chain Ethanolamine deaminase small subunit JW2433 b2440 protein protein ecoli Escherichia coli (strain K12) MDQKQIEEIVRSVMASMGQAAPAPSEAKCATTNCAAPVTSESCALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR (2s)-2-aminopropan-1-ol (2S)-2-aminopropan-1-ol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) eutb-eutc-2 1537713 n/a 1537714 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 n/a 1537715 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 n/a 1537716 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1537717 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 2.1A Rworking = 0.25 Rfree = 0.28 Supp. Table 1 eutb-eutc-1 1537713 n/a 1537715 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 n/a 1537717 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1537716 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1537718 unspecified role unspecified role unspecified role unspecified role Stoichiometry: 2.0 direct interaction direct interaction false false false 2.25A Rworking = 0.24 Rfree = 0.26 SUpp. Table 1