IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ baan-2010-1 In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo. human-retina Human retina cells retina retinal tissue pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Baan B., Pardali E., ten Dijke P., van Dam H. Adenovirus-transformed human embryonic retinoblasts (Ad-HERs). vdam@lumc.nl Mol. Cell Proteomics (1535-9476) 2010 Only protein-protein interactions imex curation baan-2010-4 In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Baan B., Pardali E., ten Dijke P., van Dam H. vdam@lumc.nl Mol. Cell Proteomics (1535-9476) 2010 Only protein-protein interactions imex curation baan-2010-2 In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo. human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Baan B., Pardali E., ten Dijke P., van Dam H. vdam@lumc.nl Mol. Cell Proteomics (1535-9476) 2010 Only protein-protein interactions imex curation baan-2010-3 In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo. human-mda_mb_436 Human mammary gland adenocarcinoma mda_mb_436 Human mammary gland adenocarcinoma ATCC catalog # HTB-130 ATCC catalog# HTB-130 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Baan B., Pardali E., ten Dijke P., van Dam H. vdam@lumc.nl Mol. Cell Proteomics (1535-9476) 2010 Only protein-protein interactions imex curation fosl1_human Fos-related antigen 1 FOSL1 FRA1 protein protein human Homo sapiens Human MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL atf2_human Cyclic AMP-dependent transcription factor ATF-2 ATF2 CREB2 CREBP1 Activating transcription factor 2 cAMP response element-binding protein CRE-BP1 HB16 Cyclic AMP-responsive element-binding protein 2 protein protein human Homo sapiens Human MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPSSQSQPSGS fosl1-jun-1 1530848 n/a 1530852 unspecified role unspecified role neutral component neutral component n/a 1530853 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 4 B/C-2 TPA (PMA)-tetradecanoyl phorbol acetate, or phorbol 12-myristate 13-acetate. A mitogen, and used here to increase expression of c-Jun and Fra-1. fos-jun-1 1530848 n/a 1530854 unspecified role unspecified role neutral component neutral component n/a 1530853 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1C, 3B/D TPA (PMA)-tetradecanoyl phorbol acetate, or phorbol 12-myristate 13-acetate. A mitogen, and used here to increase expression of c-Jun and c-Fos. fos-jun-1 1530848 n/a 1530855 unspecified role unspecified role neutral component neutral component n/a 1530853 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1C, Supp 1C, 3C/E. The addition of TPA (PMA)-tetradecanoyl phorbol acetate, or phorbol 12-myristate 13-acetate, did not affect the interaction to a significant degree. Using tethered (linked) heterodimers of ATF2 and c-Jun also gave a positive PLA signal. fos-jun-1 1530848 n/a 1530854 unspecified role unspecified role neutral component neutral component n/a 1530853 unspecified role unspecified role neutral component neutral component c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P05412:p.[Lys283Glu;Lys288Glu;Arg302Glu;Gln304Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false proximity proximity close-contact colocalization neighbourhood interaction false false false 2A/C atf2-jun-1 1530848 n/a 1530853 unspecified role unspecified role neutral component neutral component c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1530855 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 2B/D fos-jun-1 1530848 n/a 1530853 competitor competitor competitor neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1530853 unspecified role unspecified role neutral component neutral component n/a 1530854 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 3 B/D fos-jun-1 1530848 n/a 1530855 unspecified role unspecified role neutral component neutral component n/a 1530853 competitor competitor competitor neutral component neutral component regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1530853 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 3C/E atf2-fos-1 1530848 n/a 1530853 unspecified role unspecified role neutral component neutral component n/a 1530853 competitor competitor competitor neutral component neutral component regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1530852 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 4 B/C TPA (PMA)-tetradecanoyl phorbol acetate, or phorbol 12-myristate 13-acetate. A mitogen, and used here to increase expression of c-Jun and Fra-1. fosl1-jun-1 1530849 n/a 1530854 unspecified role unspecified role neutral component neutral component n/a 1530853 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false Supp 2B MMS (methyl methane-sulfonate) -an alkylating agent and carcinogen Treatment of basal-like MDA-MB231 cells with methyl methanesulfonate strongly induced both c-Fos and c-Jun. fos-fosl1-3 1530849 n/a 1530852 unspecified role unspecified role neutral component neutral component n/a 1530853 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5A, 6B. In all three more invasive and aggressive cancer cell lines, (MDA-MB231, MDA-MB436 and MDA-MB435) high numbers of c-Jun/Fra1 signals were detected by PLA, whereas much lower numbers of c-Jun/Fra1 RCPs were obtained in the less invasive luminal-like cells (MCF7, T47D, and ZR75). Levels of c-Jun/ATF2 and c-Jun/c-Fos signals were low in all cancer lines examined. fos-fosl1-1 1530850 n/a 1530853 unspecified role unspecified role neutral component neutral component n/a 1530852 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5A In all three more invasive and aggressive cancer cell lines, (MDA-MB231, MDA-MB436 and MDA-MB435) high numbers of c-Jun/Fra1 signals were detected by PLA, whereas much lower numbers of c-Jun/Fra1 RCPs were obtained in the less invasive luminal-like cells (MCF7, T47D, and ZR75). Levels of c-Jun/ATF2 and c-Jun/c-Fos signals were low in all cancer lines examined. fos-fosl1-2 1530851 n/a 1530853 unspecified role unspecified role neutral component neutral component n/a 1530852 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5A In all three more invasive and aggressive cancer cell lines, (MDA-MB231, MDA-MB436 and MDA-MB435) high numbers of c-Jun/Fra1 signals were detected by PLA, whereas much lower numbers of c-Jun/Fra1 RCPs were obtained in the less invasive luminal-like cells (MCF7, T47D, and ZR75). Levels of c-Jun/ATF2 and c-Jun/c-Fos signals were low in all cancer lines examined.