UniProt UniProt http://www.uniprot.org arsova-2010-1 Plastidial thioredoxin z interacts with two fructokinase-like proteins in a thiol-dependent manner: evidence for an essential role in chloroplast development in Arabidopsis and Nicotiana benthamiana. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Arsova B., Hoja U., Wimmelbacher M., Greiner E., Ustün S., Melzer M., Petersen K., Lein W., Börnke F. fboernke@biologie.uni-erlangen.de Arabidopsis tissue cDNAs Plant Cell (1040-4651) 2010 Only protein-protein interactions imex curation arsova-2010-2 Plastidial thioredoxin z interacts with two fructokinase-like proteins in a thiol-dependent manner: evidence for an essential role in chloroplast development in Arabidopsis and Nicotiana benthamiana. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Arsova B., Hoja U., Wimmelbacher M., Greiner E., Ustün S., Melzer M., Petersen K., Lein W., Börnke F. fboernke@biologie.uni-erlangen.de Plant Cell (1040-4651) 2010 Only protein-protein interactions imex curation arsova-2010-3 Plastidial thioredoxin z interacts with two fructokinase-like proteins in a thiol-dependent manner: evidence for an essential role in chloroplast development in Arabidopsis and Nicotiana benthamiana. tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Arsova B., Hoja U., Wimmelbacher M., Greiner E., Ustün S., Melzer M., Petersen K., Lein W., Börnke F. fboernke@biologie.uni-erlangen.de Plant Cell (1040-4651) 2010 Only protein-protein interactions imex curation citrx_arath Thioredoxin-like protein CITRX, chloroplastic CITRX Cf-9-interacting thioredoxin PAP10 PEP-associated protein 10 TRX P TRX Z Thioredoxin Trx p Thioredoxin Z F3E22.13 At3g06730 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MALVQSRTFPHLNTPLSPILSSLHAPSSLFIRREIRPVAAPFSSSTAGNLPFSPLTRPRKLLCPPPRGKFVREDYLVKKLSAQELQELVKGDRKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLPTLFFISPDPSKDAIRTEGLIPLQMMHDIIDNEM sckl1_arath Fructokinase-like 1, chloroplastic FLN1 PAP6 PEP-associated protein 6 PFKB2 pfkB-type carbohydrate kinase family protein 2 F24B22.50 At3g54090 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASLLIFPHLHHFDSSLDRREVLVVRHSQASRRFLTPKASINGSGITNGAAAETTSKPSRKGRKKKQTSTVIEKDNTETDPELNPELADYDDGIEFPYDDPPLVCCFGAVQKEFVPVVRVHDNPMHPDMYSQWKMLQWDPPEFGRAPGGPPSNVAISHVRLGGRAAFMGKVGEDDFGDELVLMMNQERVQTRAVKFDENSKTACTRVKIKFKDGKMMAETVKEPPEDSLFASELNLAVLKEARIFHFNSEVLTSPTMQSTLFTAIQWSKKFGGLIFFDLNLPLPLWRSRNETRKLIKKAWNEANIIEVSQQELEFLLDEDYYERRRNYTPQYFAEDFDQTKNRRDYYHYTPEEIKSLWHDKLKLLVVTDGTLRLHYYTPTFDGVVIGTEDVLITPFTCDRTGSGDAVVAGIMRKLTTCPEMFEDQDVMERQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKEQVYVPSMW sckl2_arath Fructokinase-like 2, chloroplastic FLN2 PFKB1 pfkB-type carbohydrate kinase family protein 1 F23O10.21 F4N2.16 At1g69200 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASLSFTQFLSFPRCNADVPCLLQSHGFVKFRGERWNGKQSFSMAAGRRKLSESAPLEEEGNDGNGAVVGKKPSKSVKRTTKKKVVVKDEPLEEISEFLVDNDDVLDKESIVSALKPKKTRTRKKAAAASSDVEEVKTEKKVRRKRTVKKDKDVEDDLATIMDAEVSDVEEALAVESTDTESEEEEIDLSKHEGEDISHTYGWPPLVCCFGSAQHAFVPSGRPANRLLDYELHERMRDAKWAPEKYIRAPGGCAGGVAIALASLGGKVAFMGKLGADDYGQAMLYYLNVCKVQTRSVKIDGKRVTACSTMKISKRGRLKSTCIKPCAEDSLSKSEINVDVLKEAKMFYFSTHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWHSSEETKSFIQEVWNLADVIEITKQELEFLCGIEPTEEFDTENNDISKFVHYPPETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDVPITPFTRDMSASGDGIVAGLIRMLTVQPDLMNNKGYLERTARYAIECGIIDQWLLAQTRGYPPKDDMEEEEDDEEEDEVESDPNGIRSITEKEYRTSKPYDEPDGPYVMKPVEEREYKKLELVGSMFEDGSL citrx-fln1 1568982 n/a 1568985 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1568986 unspecified role unspecified role prey prey physical association physical association false false false citrx-fln2 1568982 n/a 1568987 unspecified role unspecified role prey prey n/a 1568985 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false citrx-fln1 1568983 n/a 1568985 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9M7X9:p.Cys106Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 1568986 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9M394:p.Cys106Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9M394:p.[Cys105Ala;Cys106Ser] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false 1569001 1568998 physical association physical association false false false Fig.5, Table 1 citrx-fln2-1 1568983 n/a 1568985 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9M7X9:p.Cys106Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 1568987 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false F4I0K2:p.[Cys208Ala;Cys209Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false F4I0K2:p.Cys208Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false F4I0K2:p.Cys209Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false 1569009 1569006 physical association physical association false false false Fig.5, Table 1 citrx-fln1 1568984 n/a 1568985 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1568986 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6C citrx-fln2-2 1568984 n/a 1568985 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1568987 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6C