UniProt UniProt http://www.uniprot.org chi-2010-1 Overexpression of optineurin E50K disrupts Rab8 interaction and leads to a progressive retinal degeneration in mice. rat-rgc5 Rattus norvegicus rgc5 rgc5 bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Chi Z.L., Akahori M., Obazawa M., Minami M., Noda T., Nakaya N., Tomarev S., Kawase K., Yamamoto T., Noda S., Sasaoka M., Shimazaki A., Takada Y., Iwata T. similar results have been obtained using transfected COS1 cells. KG inactive fragments, mKG_N and mKG_C, have been fused N- and C-terminally to cDNA constructs (fig 6A). However, representation of results in fig 6B did not allow the differentiation of exact experimantal set ups. Origin of transfected constructs has been communicated by the authors. iwatatakeshi@kankakuki.go.jp Hum. Mol. Genet. (0964-6906) 2010 imex curation Only protein-protein interactions chi-2010-2 Overexpression of optineurin E50K disrupts Rab8 interaction and leads to a progressive retinal degeneration in mice. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Chi Z.L., Akahori M., Obazawa M., Minami M., Noda T., Nakaya N., Tomarev S., Kawase K., Yamamoto T., Noda S., Sasaoka M., Shimazaki A., Takada Y., Iwata T. similar results have been obtained using transfected COS1 cells. KG inactive fragments, mKG_N and mKG_C, have been fused N- and C-terminally to cDNA constructs (fig 6A). However, representation of results in fig 6B did not allow the differentiation of exact experimantal set ups. Origin of transfected constructs has been communicated by the authors. iwatatakeshi@kankakuki.go.jp Hum. Mol. Genet. (0964-6906) 2010 imex curation Only protein-protein interactions rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL optn_human Optineurin HYPL Optic neuropathy-inducing protein E3-14.7K-interacting protein FIP-2 Huntingtin-interacting protein L Huntingtin yeast partner L NEMO-related protein Transcription factor IIIA-interacting protein OPTN FIP2 GLC1E NRP HIP7 Huntingtin-interacting protein 7 protein protein human Homo sapiens Human MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNEKQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII optn-rab8a-3 1560152 n/a 1560154 unspecified role unspecified role neutral component neutral component region kusabira-green kusabira-green protein tag kusabira-green undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false constitutively active mutant locked in the active GTP-bound form P61006:p.Thr22Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false GDP-bound form n/a 1560155 unspecified role unspecified role neutral component neutral component Q96CV9:p.Glu50Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false UniProt FTId: VAR_021539; dbSNP:rs28939688; involved in GLC1E region kusabira-green kusabira-green protein tag kusabira-green undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6B optn-rab8a-4 1560153 n/a 1560155 unspecified role unspecified role neutral component neutral component Q96CV9:p.Glu50Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false UniProt FTId: VAR_021539; dbSNP:rs28939688; involved in GLC1E region kusabira-green kusabira-green protein tag kusabira-green undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1560154 unspecified role unspecified role neutral component neutral component P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false constitutively active mutant locked in the active GTP-bound form region kusabira-green kusabira-green protein tag kusabira-green undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6C