UniProt UniProt http://www.uniprot.org ohbayashi-2008a-2 Physical and functional interactions between ZIP kinase and UbcH5. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ohbayashi N., Okada K., Kawakami S., Togi S., Sato N., Ikeda O., Kamitani S., Muromoto R., Sekine Y., Kawai T., Akira S., Matsuda T. Origin of transfected DAPK3/ZIPK according pmid 9488481(publication Ref. 1). Origin of transfected UBE2D1, UBE2D2 and UBE2D3 according pmids 8530467 and 8090726 (following pmid 10329681 publication Ref 7.) tmatsuda@pharm.hokudai.ac.jp mouse 11-day embryo Biochem. Biophys. Res. Commun. (0006-291X) 2008 imex curation Only protein-protein interactions ohbayashi-2008a-1 Physical and functional interactions between ZIP kinase and UbcH5. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ohbayashi N., Okada K., Kawakami S., Togi S., Sato N., Ikeda O., Kamitani S., Muromoto R., Sekine Y., Kawai T., Akira S., Matsuda T. Origin of transfected DAPK3/ZIPK according pmid 9488481(publication Ref. 1). Origin of transfected UBE2D1, UBE2D2 and UBE2D3 according pmids 8530467 and 8090726 (following pmid 10329681 publication Ref 7.) tmatsuda@pharm.hokudai.ac.jp mouse 11-day embryo Biochem. Biophys. Res. Commun. (0006-291X) 2008 imex curation Only protein-protein interactions dapk3_mouse Death-associated protein kinase 3 Dapk3 Zipk DAP-like kinase ZIP-kinase MYPT1 kinase protein protein mouse Mus musculus Mouse MSTFRQEDVEDHYEMGEELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREEIEREVSILREIRHPNIITLHDVFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKVRRREDGARKPERRRLRAARLREYSLKSHSSMPRNTSYASFERFSRVLEDVAAAEQGLRELQRGRRQCRERVCALRAAAEQREARCRDGSAGLGRDLRRLRTELGRTEALRTRAQEEARAALLGAGGLKRRLCRLENRYDALAAQVAAEVQFVRDLVRALEQERLQAECGVR ub2d3_human Ubiquitin-conjugating enzyme E2 D3 UBC5C Ubiquitin-protein ligase D3 Ubiquitin carrier protein D3 Ubiquitin-conjugating enzyme E2-17 kDa 3 Ubiquitin-conjugating enzyme E2(17)KB 3 UBE2D3 UBCH5C (E3-independent) E2 ubiquitin-conjugating enzyme D3 E2 ubiquitin-conjugating enzyme D3 protein protein human Homo sapiens Human MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM ub2d1_human Ubiquitin-conjugating enzyme E2 D1 Ubiquitin-protein ligase D1 Ubiquitin carrier protein D1 UbcH5 Ubiquitin-conjugating enzyme E2-17 kDa 1 Ubiquitin-conjugating enzyme E2(17)KB 1 UBC4/5 homolog Stimulator of Fe transport UBE2D1 UBCH5 UBCH5A SFT UBC5A (E3-independent) E2 ubiquitin-conjugating enzyme D1 E2 ubiquitin-conjugating enzyme D1 protein protein human Homo sapiens Human MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM ub2d2_human Ubiquitin-conjugating enzyme E2 D2 UBC5B UBCH4 UBE2D2 UBC4 UBCH5B Ubiquitin-protein ligase D2 Ubiquitin carrier protein D2 Ubiquitin-conjugating enzyme E2-17 kDa 2 Ubiquitin-conjugating enzyme E2(17)KB 2 PUBC1 p53-regulated ubiquitin-conjugating enzyme 1 (E3-independent) E2 ubiquitin-conjugating enzyme D2 E2 ubiquitin-conjugating enzyme D2 protein protein human Homo sapiens Human MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM ub2d3_mouse Ubiquitin-conjugating enzyme E2 D3 Ube2d3 Ubiquitin carrier protein D3 Ubiquitin-conjugating enzyme E2(17)KB 3 Ubiquitin-conjugating enzyme E2-17 kDa 3 Ubiquitin-protein ligase D3 (E3-independent) E2 ubiquitin-conjugating enzyme D3 E2 ubiquitin-conjugating enzyme D3 protein protein mouse Mus musculus Mouse MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM dapk3-ube2d3-2 1562880 n/a 1562882 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1562883 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1C ube2d3-dapk3 1562880 n/a 1562883 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false UBE2D3/UBCH5C ubiquitin-deficient mutant also interacts n/a 1562882 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A and D ube2d1-dapk3 1562880 n/a 1562884 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1562882 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1D ube2d2-dapk3 1562880 n/a 1562882 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1562885 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1D dapk3-ube2d3 1562881 n/a 1562882 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1562886 unspecified role unspecified role prey prey physical association physical association false false false no figure