UniProt UniProt http://www.uniprot.org takamoto-2006-3 Novel ZIP kinase isoform lacks leucine zipper. in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Takamoto N., Komatsu S., Komaba S., Niiro N., Ikebe M. Origin of PPP1R12A/Mypt1 and recombinant DAPK3/ZIPK according ref. 6 (pmid 11384979). Phosphorylation assays with myosin and MLC and MLC20 as substrates (fig 2 and 4) not included as proteins cannot be mapped to UniProt. mitsuo.ikebe@umassmed.edu Arch. Biochem. Biophys. (0003-9861) 2006 Only protein-protein interactions imex curation takamoto-2006-2 Novel ZIP kinase isoform lacks leucine zipper. human-arpe_19 Homo sapiens retinal pigment epithelial cell line ARPE-19 arpe_19 Human retinal pigment epithelial cells ARPE-19 The ATCC reference is CRL-2302. ARPE-19 is a spontaneously arising retinal pigment epithelia (RPE) cell line derived in 1986 by Amy Aotaki-Keen from the normal eyes of a 19-year-old male who died from head trauma in a motor vehicle accident. The cells were subjected to selective trypsinization for the first four passages to remove superficial cells before passaging the cuboidal basal layer. By passage 5, the cultures appeared to be rapidly growing RPE cells, which would form cobblestone monolayers, which pigmented after several months in culture. The line was established in a 1:1 mixture of Dulbecco's modified Eagles medium and Ham's F12 medium with HEPES buffer containing 20% fetal bovine serum, 56 mM final concentration sodium bicarbonate and 2 mM L-glutamine and incubated at 37C in 10% CO2. These cells form stable monolayers, which exhibit morphological and functional polarity. ARPE-19 expresses the RPE-specific markers CRALBP and RPE-65. The cells exhibit morphological polarization when plated on laminin-coated Transwell-COL filters in medium with a low serum concentration. They form tight-junctions with transepithelial resistance of monolayers reaching a maximum of 50 to 100 ohms/cm2 after 4 weeks of culture. The cells are diploid and can be carried for over 30 passages. Progeny were found to undergo an additional 48 population doublings in longevity trials performed during characterization at ATCC. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Takamoto N., Komatsu S., Komaba S., Niiro N., Ikebe M. Origin of PPP1R12A/Mypt1 and recombinant DAPK3/ZIPK according ref. 6 (pmid 11384979). Phosphorylation assays with myosin and MLC and MLC20 as substrates (fig 2 and 4) not included as proteins cannot be mapped to UniProt. mitsuo.ikebe@umassmed.edu Arch. Biochem. Biophys. (0003-9861) 2006 Only protein-protein interactions imex curation takamoto-2006-1 Novel ZIP kinase isoform lacks leucine zipper. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Takamoto N., Komatsu S., Komaba S., Niiro N., Ikebe M. Origin of PPP1R12A/Mypt1 and recombinant DAPK3/ZIPK according ref. 6 (pmid 11384979). Phosphorylation assays with myosin and MLC and MLC20 as substrates (fig 2 and 4) not included as proteins cannot be mapped to UniProt. mitsuo.ikebe@umassmed.edu Arch. Biochem. Biophys. (0003-9861) 2006 Only protein-protein interactions imex curation mypt1_rat Protein phosphatase 1 regulatory subunit 12A Ppp1r12a Mbs Mypt1 Myosin phosphatase-targeting subunit 1 Protein phosphatase myosin-binding subunit MBSP Serine/threonine protein phosphatase PP1 smooth muscle regulatory subunit M110 Protein phosphatase subunit 1M protein protein rat Rattus norvegicus (Rat) Rat MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHISDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVDNLCDMETVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSPLIESTANMENNQPQKTFKNKETLIIEPEKNASRIESLEQEKADEEEEGKKDESSCSSEEDEEDDSESEAETDKTKPMASVTNAHTASTQAAPAAVTTPTLSSNQGTPTSPVKKFPTSTTKISPKEEERKDESPASWRLGLRKTGSYGALAEITASKEAQKEKDTAGVIRSASSPRLSSSLDNKEKEKDNKGTRLAYVAPTIPRRLGSTSDIEEKENRESSNLRTSSSYTRRKWEDDLKKNSSINEGSTYHRSCSFGRRQDDLISCSVPSTTSTPTVTSAAGLQKSFLSSTSTTAKTPPGSSPAGTQSSTSNRLWAEDSTEKEKDSAPTAATILVAPTVVSAAASSTTALTTTTAGTLSSTSEVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTREQENEEKDKEEKEKQDKEKQEEKKESEVSREDEYKQKYSRTYDETYARYRPVSTSSSSTPSSSSLSTLGSSLYASSQLNRPNSLVGITSAYSRGLTKDNEREGEKKEEEKEGEDKSQPKSIRERRRPREKRRSTGVSFWTQDSDENEQERQSDTEDGSSKRDTQTDSVSRYDSSSTSSSDRYDSLLGRSASYSYLEERKPYGSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDLKLQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGALIRVISKLSK o43293-2 Death-associated protein kinase 3 ZIPK-S DAPK3 ZIPK DAP-like kinase MYPT1 kinase Zipper-interacting protein kinase protein protein human Homo sapiens Human MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSASPIVAPVDA The internal splice site between exon 8 and the 3' UTR, which yields this truncated isoform, is non-canonical. o43293-1 Death-associated protein kinase 3 ZIPK-L DAPK3 ZIPK DAP-like kinase MYPT1 kinase Zipper-interacting protein kinase protein protein human Homo sapiens Human MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRYEALAKQVASEMRFVQDLVRALEQEKLQGVECGLR ml12b_human Myosin regulatory light chain 12B MYL12B MRLC2 Myosin regulatory light chain 2-B, smooth muscle isoform MLC-2A SHUJUN-1 MYLC2B Myosin regulatory light chain MRLC2 Myosin regulatory light chain 20 kDa protein protein human Homo sapiens Human MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD dapk3-ppp1r12a-3 1565015 n/a 1565018 enzyme target enzyme target substrate substrate neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1565019 enzyme enzyme neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation false false false 2C and D Phosphorylated and non-phosphorylated DAPK3/ZIPK interacted. Phosphorylation of PPP1R12A/Mypt1 decreases interaction. ATP Q10728 phosphores dapk3-ppp1r12a-5 1565015 n/a 1565020 enzyme enzyme neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1565018 enzyme target enzyme target substrate substrate neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation false false false 2D Phosphorylated and non-phosphorylated DAPK3/ZIPK interacted. Phosphorylation of PPP1R12A/Mypt1 decreases interaction. ATP Q10728 phosphores dapk3-3 1565015 n/a 1565019 unspecified role unspecified role putative self putative self region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation false true false 3A and 4A and B ATP O43293-2 phosphores dapk3-3 1565015 n/a 1565020 unspecified role unspecified role putative self putative self region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation false true false 3A and B. 4A and B DAPK3/ZIPK mutant ser110ala/thr112ala does not change phosphorylation status. o43293-1 phosphores dapk3-myl12b 1565016 n/a 1565019 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1565021 unspecified role unspecified role neutral component neutral component possible phosphoser-20 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false possible phosphothr-19 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 6Bd dapk3-myl12b-2 1565016 n/a 1565020 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1565021 unspecified role unspecified role neutral component neutral component possible phosphoser-20 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false possible phosphothr-19 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 6Ad dapk3-ppp1r12a 1565017 n/a 1565018 unspecified role unspecified role prey prey region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yes spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1565019 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association false false false 5A , B and C Phosphorylated and non-phosphorylated DAPK3/ZIPK interacted. Phosphorylation of PPP1R12A/Mypt1 decreases interaction. ATP