IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ luo-2003-1 Induction of Grp78/BiP by translational block: activation of the Grp78 promoter by ATF4 through and upstream ATF/CRE site independent of the endoplasmic reticulum stress elements. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Luo S., Baumeister P., Yang S., Abcouwer S.F., Lee A.S. amylee@hsc.usc.edu J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation atf1_mouse Cyclic AMP-dependent transcription factor ATF-1 Atf1 Activating transcription factor 1 TCR-ATF1 protein protein mouse Mus musculus Mouse MEDSHKSNTTETASQPGSTVAGPHVSQIVHQVSSLSESEESQDSSDSIGSSQKAHGILARRPSYRKILKDLSSEDTRGRKGEGENPSISAITSMSVPAPIYQTSSGQYIAIAPNGALQLASPSTDGVQALQTLTMTNSSSTQQGTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLASQTTKTDDPQLRREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSHKSV atf4_mouse Cyclic AMP-dependent transcription factor ATF-4 Atf4 C/EBP-related ATF Activating transcription factor 4 Creb2 Cyclic AMP-responsive element-binding protein 2 protein protein mouse Mus musculus Mouse MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWPAMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFPCSPGVLSSTPEHSFSLELGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP creb1_mouse Cyclic AMP-responsive element-binding protein 1 Creb1 Creb-1 protein protein mouse Mus musculus Mouse MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD atf1-atf4 1766637 n/a 1766638 unspecified role unspecified role bait bait n/a 1766639 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7a (lanes 4 & 7) The IP antibody recognises both, ATF1 & CREB1. Therefore, two interactions have been curated, ATF1-ATF4 and ATF1-CREB1. ATF4 only interacts if an agonist is added. thapsigargin (CHEBI:9516) tunicamycin (CHEBI:29699) creb1-atf4 1766637 n/a 1766640 unspecified role unspecified role bait bait n/a 1766639 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7a (lanes 4 & 7) The IP antibody recognises both, ATF1 & CREB1. Therefore, two interactions have been curated, ATF1-ATF4 and ATF1-CREB1. ATF4 only interacts if an agonist is added. thapsigargin (CHEBI:9516) tunicamycin (CHEBI:29699)