UniProt UniProt http://www.uniprot.org young-2002-1 Minute virus of mice NS1 interacts with the SMN protein, and they colocalize in novel nuclear bodies induced by parvovirus infection. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Young P.J., Jensen K.T., Burger L.R., Pintel D.J., Lorson C.L. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt MVM reference proteome strain. clorson@asu.edu J. Virol. (0022-538X) 2002 imex curation Only protein-protein interactions young-2002-2 Minute virus of mice NS1 interacts with the SMN protein, and they colocalize in novel nuclear bodies induced by parvovirus infection. mouse-a92l Mus musculus A92L fibroblast cell line a9l2 A9L2 fibroblast cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young P.J., Jensen K.T., Burger L.R., Pintel D.J., Lorson C.L. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt MVM reference proteome strain. clorson@asu.edu J. Virol. (0022-538X) 2002 imex curation Only protein-protein interactions young-2002-3 Minute virus of mice NS1 interacts with the SMN protein, and they colocalize in novel nuclear bodies induced by parvovirus infection. mouse-a92l Mus musculus A92L fibroblast cell line a9l2 A9L2 fibroblast cell line fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Young P.J., Jensen K.T., Burger L.R., Pintel D.J., Lorson C.L. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt MVM reference proteome strain. clorson@asu.edu J. Virol. (0022-538X) 2002 imex curation Only protein-protein interactions young-2002-4 Minute virus of mice NS1 interacts with the SMN protein, and they colocalize in novel nuclear bodies induced by parvovirus infection. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Young P.J., Jensen K.T., Burger L.R., Pintel D.J., Lorson C.L. Virus - Publications including interactions involving viral proteins Murine A92L cells infected with MVM; cell extract 30h postinfection was used. Viral proteins have been mapped to the UniProt MVM reference proteome strain. clorson@asu.edu J. Virol. (0022-538X) 2002 imex curation Only protein-protein interactions ns1_mumip Initiator protein NS1 NS1 NCVP1 Non-capsid protein NS-1 Non-structural protein NS1 protein protein mumip Murine minute virus (strain MVM prototype) MAGNAYSDEVLGATNWLKEKSNQEVFSFVFKNENVQLNGKDIGWNSYKKELQEDELKSLQRGAETTWDQSEDMEWETTVDEMTKKQVFIFDSLVKKCLFEVLNTKNIFPGDVNWFVQHEWGKDQGWHCHVLIGGKDFSQAQGKWWRRQLNVYWSRWLVTACNVQLTPAERIKLREIAEDNEWVTLLTYKHKQTKKDYTKCVLFGNMIAYYFLTKKKISTSPPRDGGYFLSSDSGWKTNFLKEGERHLVSKLYTDDMRPETVETTVTTAQETKRGRIQTKKEVSIKTTLKELVHKRVTSPEDWMMMQPDSYIEMMAQPGGENLLKNTLEICTLTLARTKTAFDLILEKAETSKLTNFSLPDTRTCRIFAFHGWNYVKVCHAICCVLNRQGGKRNTVLFHGPASTGKSIIAQAIAQAVGNVGCYNAANVNFPFNDCTNKNLIWVEEAGNFGQQVNQFKAICSGQTIRIDQKGKGSKQIEPTPVIMTTNENITVVRIGCEERPEHTQPIRDRMLNIHLTHTLPGDFGLVDKNEWPMICAWLVKNGYQSTMASYCAKWGKVPDWSENWAEPKVPTPINLLGSARSPFTTPKSTPLSQNYALTPLASDLEDLALEPWSTPNTPVAGTAETQNTGEAGSKACQDGQLSPTWSEIEEDLRACFGAEPLKKDFSEPLNLD 50298F27662E3C1D smn_human Survival motor neuron protein SMN1 SMN SMNT SMN2 SMNC Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN smn_mouse Survival motor neuron protein Smn1 Smn protein protein mouse Mus musculus Mouse MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETPDKPKGTARRKPAKKNKSQKKNATTPLKQWKVGDKCSAVWSEDGCIYPATITSIDFKRETCVVVYTGYGNREEQNLSDLLSPTCEVANSTEQNTQENESQVSTDDSEHSSRSLRSKAHSKSKAAPWTSFLPPPPPMPGSGLGPGKPGLKFNGPPPPPPLPPPPFLPCWMPPFPSGPPIIPPPPPISPDCLDDTDALGSMLISWYMSGYHTGYYMGFRQNKKEGKCSHTN ns1-smn1 1536435 n/a 1536439 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1536440 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1A smn1-ns1 1536436 n/a 1536439 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1536441 unspecified role unspecified role bait bait physical association physical association false false false 1B smn1-ns1-1 1536437 n/a 1536439 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1536441 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2 upper smn1-ns1-3 1536438 n/a 1536441 unspecified role unspecified role bait bait mouse-a92l Mus musculus A92L fibroblast cell line a9l2 A9L2 fibroblast cell line n/a 1536439 unspecified role unspecified role prey prey mouse-a92l Mus musculus A92L fibroblast cell line a9l2 A9L2 fibroblast cell line physical association physical association false false false 1C