UniProt UniProt http://www.uniprot.org masson-2001-2 Identification and purification of two distinct complexes containing the five RAD51 paralogs. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down western blot western blot Immuno blot Immuno blot Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk Genes Dev. (0890-9369) 2001 Only protein-protein interactions imex curation masson-2001-3 Identification and purification of two distinct complexes containing the five RAD51 paralogs. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk Genes Dev. (0890-9369) 2001 Only protein-protein interactions imex curation masson-2001-4 Identification and purification of two distinct complexes containing the five RAD51 paralogs. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection electrophoresis electrophoretic mobility-based method electrophoresis weight by comassie molecular weight estimation by coomasie staining weight by comassie Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk Genes Dev. (0890-9369) 2001 Only protein-protein interactions imex curation masson-2001-1 Identification and purification of two distinct complexes containing the five RAD51 paralogs. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk Genes Dev. (0890-9369) 2001 Only protein-protein interactions imex curation masson-2001-5 Identification and purification of two distinct complexes containing the five RAD51 paralogs. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection electrophoresis electrophoretic mobility-based method electrophoresis western blot western blot Immuno blot Immuno blot Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk Genes Dev. (0890-9369) 2001 Only protein-protein interactions imex curation ra51c_human DNA repair protein RAD51 homolog 3 RAD51 homolog C RAD51C RAD51L2 RAD51-like protein 2 protein protein human Homo sapiens Human MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPALGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSLQTEGSLSTRKRSRDPEEEL xrcc3_human DNA repair protein XRCC3 XRCC3 X-ray repair cross-complementing protein 3 protein protein human Homo sapiens Human MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIFIEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGATLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH ra51b_human DNA repair protein RAD51 homolog 2 RAD51L1 RAD51B REC2 RAD51 homolog B RAD51-like protein 1 protein protein human Homo sapiens Human MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF ra51d_human DNA repair protein RAD51 homolog 4 R51H3 RAD51-like protein 3 TRAD RAD51D RAD51L3 RAD51 homolog D protein protein human Homo sapiens Human MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDRDSGRLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEMVDIGTWGTSEQSATLQGDQT xrcc2_human DNA repair protein XRCC2 XRCC2 X-ray repair cross-complementing protein 2 protein protein human Homo sapiens Human MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSHPSLCLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQKASSSSEEPSHASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC xrcc3-rad51c 1500250 n/a 1500255 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n/a 1500256 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 rad51c-rad51b 1500250 n/a 1500255 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1500257 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 4A rad51c-rad51d 1500250 n/a 1500255 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1500258 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 4B rad51c-rad51b-1 1500250 n/a 1500255 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1500257 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n/a 1500258 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association false false false 4C rad51c-xrcc3 1500251 n/a 1500255 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1500256 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 3 rad51b-rad51c 1500251 n/a 1500255 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1500257 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n/a 1500258 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n/a 1500259 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 3 rad51d-rad51b-1 1500252 n/a 1500255 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 1.0 n/a 1500259 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection Stoichiometry: 1.0 n/a 1500257 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 1.0 n/a 1500258 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection Stoichiometry: 1.0 physical association physical association false false false 5A BCDX2 complex rad51c-xrcc3-1 1500252 n/a 1500255 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 1.0 n/a 1500256 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection Stoichiometry: 1.0 physical association physical association false false false 5C rad51d-rad51b 1500253 n/a 1500255 unspecified role unspecified role prey prey n/a 1500257 unspecified role unspecified role prey prey n/a 1500259 unspecified role unspecified role prey prey n/a 1500258 unspecified role unspecified role bait bait association association false false false 1 rad51d-rad51b-2 1500254 n/a 1500255 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 1.0 n/a 1500259 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection Stoichiometry: 1.0 n/a 1500257 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 1.0 n/a 1500258 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection Stoichiometry: 1.0 physical association physical association false false false 5B