UniProt UniProt http://www.uniprot.org maeda-2000-3 Human dolichol-phosphate-mannose synthase consists of three subunits, DPM1, DPM2 and DPM3. crigr-cho_lec15 Cricetulus griseus CHO-derived Lec15 mutant cells defective in DPM synthesis cho_lec15 CHO-derived Lec15 mutant cells defective in DPM synthesis anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Maeda Y., Tanaka S., Hino J., Kangawa K., Kinoshita T. tkinoshi@biken.osaka-u.ac.jp EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation maeda-2000-1 Human dolichol-phosphate-mannose synthase consists of three subunits, DPM1, DPM2 and DPM3. human-jy25 Homo sapiens B--lymphoblastoid JY25 cells jy25 Human B-lymphoblastoid JY25 cells tap tandem affinity purification TAP TAP tap weight silver stain molecular weight estimation by silver staining weight silver stain Maeda Y., Tanaka S., Hino J., Kangawa K., Kinoshita T. Complex isolated by a two-step affinity purification step using 1) anti-FLAG and 2) glutathione beads. tkinoshi@biken.osaka-u.ac.jp EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation maeda-2000-2 Human dolichol-phosphate-mannose synthase consists of three subunits, DPM1, DPM2 and DPM3. human-jy25 Homo sapiens B--lymphoblastoid JY25 cells jy25 Human B-lymphoblastoid JY25 cells tap tandem affinity purification TAP TAP tap partial id prot seq partial identification of protein sequence partial id prot seq Maeda Y., Tanaka S., Hino J., Kangawa K., Kinoshita T. Complex isolated by a two-step affinity purification step using 1) anti-FLAG and 2) glutathione beads. tkinoshi@biken.osaka-u.ac.jp EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation maeda-2000-4 Human dolichol-phosphate-mannose synthase consists of three subunits, DPM1, DPM2 and DPM3. crigr-cho_lec15 Cricetulus griseus CHO-derived Lec15 mutant cells defective in DPM synthesis cho_lec15 CHO-derived Lec15 mutant cells defective in DPM synthesis anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Maeda Y., Tanaka S., Hino J., Kangawa K., Kinoshita T. tkinoshi@biken.osaka-u.ac.jp EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation maeda-2000-5 Human dolichol-phosphate-mannose synthase consists of three subunits, DPM1, DPM2 and DPM3. crigr-cho_lec15 Cricetulus griseus CHO-derived Lec15 mutant cells defective in DPM synthesis cho_lec15 CHO-derived Lec15 mutant cells defective in DPM synthesis anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Maeda Y., Tanaka S., Hino J., Kangawa K., Kinoshita T. tkinoshi@biken.osaka-u.ac.jp EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation dpm1_human Dolichol-phosphate mannosyltransferase subunit 1 DPM1 Dolichol-phosphate mannose synthase subunit 1 Dolichyl-phosphate beta-D-mannosyltransferase subunit 1 Mannose-P-dolichol synthase subunit 1 protein protein human Homo sapiens Human MASLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSDRILLRPREKKLGLGTAYIHGMKHATGNYIIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRGANFLTQILLRPGASDLTGSFRLYRKEVLEKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT dpm3_human Dolichol-phosphate mannosyltransferase subunit 3 DPM3 Dolichol-phosphate mannose synthase subunit 3 Dolichyl-phosphate beta-D-mannosyltransferase subunit 3 Mannose-P-dolichol synthase subunit 3 Prostin-1 protein protein human Homo sapiens Human MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGLRF dpm2_rat Dolichol phosphate-mannose biosynthesis regulatory protein Dpm2 Dolichol-phosphate mannose synthase subunit 2 protein protein rat Rattus norvegicus (Rat) Rat MATGTDQAVGFGLVAVSLIIFTYYTTWVILLPFIDSQHVIHKYFLPRAYAVLLPLAAGLLLLLFVGLFITYVLLKSQKVTKKAQ dpm2_human Dolichol phosphate-mannose biosynthesis regulatory protein DPM2 Dolichol-phosphate mannose synthase subunit 2 My026 protein protein human Homo sapiens Human MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKTKRVTKKAQ dpm1-dpm3-1 1478726 n/a 1478731 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1478732 unspecified role unspecified role prey prey physical association physical association false false false 4A dpm2-dpm3-1 1478726 n/a 1478733 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9Z325:p.[Phe21Leu;Tyr23Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1478732 unspecified role unspecified role prey prey physical association physical association false false false 4A dpm1-dpm2-1 1478727 n/a 1478732 unspecified role unspecified role prey prey n/a 1478734 unspecified role unspecified role prey prey n/a 1478731 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1A dpm1-dpm2-2 1478728 n/a 1478731 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1478734 unspecified role unspecified role prey prey n/a 1478732 unspecified role unspecified role prey prey association association false false false 1A dpm3-dpm2 1478729 n/a 1478733 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9Z325:p.[Phe21Leu;Tyr23Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1478732 unspecified role unspecified role bait bait physical association physical association false false false 4B dpm3-dpm2-1 1478730 n/a 1478734 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1478732 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4C