IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hart-1999-1 A structure-based mechanism for copper-zinc superoxide dismutase. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hart P.J., Balbirnie M.M., Ogihara N.L., Nersissian A.M., Weiss M.S., Valentine J.S., Eisenberg D. david@mbi.ucla.edu Biochemistry (0006-2960) 1999 Only protein-protein interactions imex curation sodc_yeast Superoxide dismutase [Cu-Zn] SOD1 J1968 YJR104C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN E263A74679AF11F7 copper(2+) Copper (Cu2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) zinc(2+) zinc(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) copper_2__-sod1-1 1478993 n/a 1478994 unspecified role unspecified role neutral component neutral component P00445:p.Phe46Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 n/a 1478995 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 n/a 1478996 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 direct interaction direct interaction false false false Table 2 1F1A 1.8A 1F1D 2.1A 1F1A Rworking = 0.2 Rfree = 0.23 1F1D Rworking = 0.23 Rfree = 0.28 copper_2__-sod1-2 1478993 n/a 1478996 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 n/a 1478994 unspecified role unspecified role neutral component neutral component yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 n/a 1478995 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 direct interaction direct interaction false false false Table 2 1.35A Rworking = 0.17