IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yuzhakov-1999-1 Trading places on DNA--a three-point switch underlies primer handoff from primase to the replicative DNA polymerase. in vitro In vitro solid phase assay solid phase assay autoradiography autoradiography Yuzhakov A., Kelman Z., O'Donnell M. odonnel@rockvax.rockefeller.edu Cell (0092-8674) 1999 Only protein-protein interactions imex curation yuzhakov-1999-2 Trading places on DNA--a three-point switch underlies primer handoff from primase to the replicative DNA polymerase. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Yuzhakov A., Kelman Z., O'Donnell M. oligo(dT) is 100 nt long. odonnel@rockvax.rockefeller.edu Cell (0092-8674) 1999 Only protein-protein interactions imex curation dnag_ecoli DNA primase dnaG dnaP parB b3066 JW3038 protein protein ecoli Escherichia coli (strain K12) MAGRIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFGCGAHGNAIDFLMNYDKLEFVETVEELAAMHNLEVPFEAGSGPSQIERHQRQTLYQLMDGLNTFYQQSLQQPVATSARQYLEKRGLSHEVIARFAIGFAPPGWDNVLKRFGGNPENRQSLIDAGMLVTNDQGRSYDRFRERVMFPIRDKRGRVIGFGGRVLGNDTPKYLNSPETDIFHKGRQLYGLYEAQQDNAEPNRLLVVEGYMDVVALAQYGINYAVASLGTSTTADHIQLLFRATNNVICCYDGDRAGRDAAWRALETALPYMTDGRQLRFMFLPDGEDPDTLVRKEGKEAFEARMEQAMPLSAFLFNSLMPQVDLSTPDGRARLSTLALPLISQVPGETLRIYLRQELGNKLGILDDSQLERLMPKAAESGVSRPVPQLKRTTMRILIGLLVQNPELATLVPPLENLDENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARERTHGLSNEERLELWTLNQELAKK 294CF020E7B45D94 ssb_ecoli Single-stranded DNA-binding protein Helix-destabilizing protein ssb exrB lexC b4059 JW4020 protein protein ecoli Escherichia coli (strain K12) MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF holc_ecoli DNA polymerase III subunit chi holC b4259 JW4216 protein protein ecoli Escherichia coli (strain K12) MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK 7FEFFC359B28AA88 dt-dna oligo(dT) dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) ssb-dnag 1419843 n/a 1419845 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1419846 unspecified role unspecified role bait bait direct interaction direct interaction false false false Fig. 4e, f ssb-dnag-holc 1419843 n/a 1419845 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1419846 unspecified role unspecified role bait bait n/a 1419847 competitor competitor competitor prey prey physical association physical association false false false Fig. 4e, f ssb-dt_dna-holc 1419844 n/a 1419847 competitor competitor competitor prey prey n/a 1419848 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 4.0 n/a 1419846 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4a Experiments were carried out at 24C and 37C. At 37C the SSB-ser113pro mutant did not bind to holc. ssb-dt_dna-dnag 1419844 n/a 1419846 unspecified role unspecified role prey prey Stoichiometry: 4.0 n/a 1419845 unspecified role unspecified role prey prey n/a 1419848 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 4b Experiments were carried out at 24C and 37C.